DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Dhrs7

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001258323.1 Gene:Dhrs7 / 299135 RGDID:1565002 Length:338 Species:Rattus norvegicus


Alignment Length:212 Identity:62/212 - (29%)
Similarity:99/212 - (46%) Gaps:16/212 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WR--NKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK-----IFARQC 64
            |.  :.|..:||||.|||...|.:|:..|:.:|..|||.:.:|.::.:....|.     |.....
  Rat    46 WELTDMVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLENGNLKEKDILVLPL 110

  Fly    65 DLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALK 129
            ||.|.....:|...:.::|..|.:|:.|.|..:.:.:.|:..:..|||.:.|.:.|.|..:..|.
  Rat   111 DLTDTSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLEVFKELMNLNYLGTVSLTKCVLP 175

  Fly   130 HMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICP 194
            ||...| :|.||.:||:.|    ...|.|.|.|.|:|||:......:..|:.... .|.|.::.|
  Rat   176 HMVERK-QGKIVTVNSLAG----IASVSLSSGYCASKHALRGFFNALHSELGKYP-GITLCNVYP 234

  Fly   195 GMVDTDFLSVYSQAVAE 211
            |.|.:   :|...|:.|
  Rat   235 GPVQS---NVVKNALTE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 62/212 (29%)
YdfG 9..241 CDD:226674 61/208 (29%)
Dhrs7NP_001258323.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 61/210 (29%)
adh_short 52..250 CDD:278532 61/206 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.