DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Dhrs7l1

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001013116.1 Gene:Dhrs7l1 / 299131 RGDID:1308036 Length:324 Species:Rattus norvegicus


Alignment Length:249 Identity:79/249 - (31%)
Similarity:119/249 - (47%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK-----IFARQCDLND 68
            :||..:||||.|||...|.:|:..|:.:|..|||.:.:|.::.:....|.     |.....||.|
  Rat    49 DKVVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLENGNLKEKDILVLPLDLAD 113

  Fly    69 EEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDI-KELFDTNVVATASCLREALKHMA 132
            ......|...:.::|..|.:|:.|.|:..|: |.|:...|| |.|.:.|.:.|.|..:..|.||.
  Rat   114 TSSHDIATKTVLQEFGRIDILVNNGGVAHAS-LVENTNMDIFKVLIEVNYLGTVSLTKCVLPHMM 177

  Fly   133 AVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            . :.:|.||||.|::|    .||.||.|.|.|:|.|:......:|.|: |....|.|:.||||.|
  Rat   178 E-RNQGKIVVMKSLVG----IVPRPLCSGYAASKLALRGFFDVLRTEL-FDYPGITLSMICPGPV 236

  Fly   198 DTD-FLSVYSQAVAE--LPKLQARDVAKAVLYALNTPDGVQ---------VEDI 239
            .:: |.:.::....|  |||:.        |:.:.|...||         :|||
  Rat   237 HSNIFQNAFTGDFTETRLPKIP--------LFKMETSRCVQLILVSLANDLEDI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 79/249 (32%)
YdfG 9..241 CDD:226674 79/249 (32%)
Dhrs7l1NP_001013116.1 11beta-HSD1_like_SDR_c 47..305 CDD:187593 79/249 (32%)
adh_short 50..247 CDD:278532 68/203 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.