DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Dhrs7b

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:254 Identity:76/254 - (29%)
Similarity:120/254 - (47%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YWRNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIE----ALRDQVTGVGKIFARQC-- 64
            |.||.|.|||||:.|:|...|.....||..||...|.|:.:|    .|.|..:..|:.. :.|  
  Rat    49 YLRNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTH-QPCVV 112

  Fly    65 --DLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREA 127
              ||.|...:|.|...|.:.|..:.:||.||||.....:|::.....:::.:.|.....:..:..
  Rat   113 TFDLADPGAIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKAL 177

  Fly   128 LKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSI 192
            |..|...| |||||.::|:.|    ::.:|..|.|.|:|||..|....:|.|:.  ..:|::|.|
  Rat   178 LPSMVERK-RGHIVAISSIQG----KISIPFRSAYAASKHATQAFFDCLRAEMK--DSDIEVTVI 235

  Fly   193 CPGMVDTDFLSVYS-----QAVAELPKLQAR-----DVAKAVLYALNTPDGVQVEDIIL 241
            .||.:.|: |||.:     .....|.|..|:     :||:.:..|:    |.:.:|::|
  Rat   236 SPGYIHTN-LSVNAVTADGSRYGALDKNTAQGRSAVEVAQDIFDAV----GKKKKDVLL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 76/254 (30%)
YdfG 9..241 CDD:226674 73/249 (29%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 75/253 (30%)
PRK06181 52..321 CDD:235726 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.