DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and rdh8a

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:214 Identity:62/214 - (28%)
Similarity:106/214 - (49%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRD------QVTGVGKIFAR-----Q 63
            ||.::||.|.|||...|:.||....      :|..:|..:||      .|...|:::.:     .
Zfish     8 KVVLITGCSSGIGLRIAVLLARDEQ------KRYHVIATMRDLKKKDRLVEAAGEVYGQTLTLLP 66

  Fly    64 CDLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREAL 128
            .|:..:|.:....|.::::.  |.|||.|||:.....:......::|.:|:||...|...::|.:
Zfish    67 LDICSDESVRQCVNSVKDRH--IDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVRMIKEVM 129

  Fly   129 KHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSIC 193
            ..|.. :..|||::|:||:|.:    .|....||.|:|.||...|:::  .:..||.|:||:.|.
Zfish   130 PDMKK-RQAGHIIIMSSVMGLQ----GVVFNDVYTASKFAIEGFCESM--AVQLLKFNVKLSLIE 187

  Fly   194 PGMVDTDFLSVYSQAVAEL 212
            ||.|.|:|.:...:.||::
Zfish   188 PGPVHTEFETKMMEEVAKM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 62/214 (29%)
YdfG 9..241 CDD:226674 62/214 (29%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 62/214 (29%)
adh_short 8..207 CDD:278532 62/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.