DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and SPAC521.03

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_593098.1 Gene:SPAC521.03 / 2543461 PomBaseID:SPAC521.03 Length:259 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:65/248 - (26%)
Similarity:119/248 - (47%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTAIELANAGMV-VVGLARRVELIEALRDQVTGVGK--IFARQCDLNDEEQ 71
            |..::||||.|||.:||.|:|....| ::..|||...:|.:..::....:  :...:.|::|.:.
pombe     7 KTILITGASSGIGKSTAFEIAKVAKVKLILAARRFSTVEEIAKELESKYEVSVLPLKLDVSDLKS 71

  Fly    72 LASAFNWIREKFQAIHVLICNAGI-LKANFLSESPTKDIKELFDTNVVATASCLREALKHMAAVK 135
            :......:.::|..|.|||.|||: |..:.:.:....|...:..|||:...:..|..|....: |
pombe    72 IPGVIESLPKEFADIDVLINNAGLALGTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLPIFYS-K 135

  Fly   136 VRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMVDTD 200
            .:|.|:.:.|:.|.   |..|. .|||.:||.|:......:|:|.  :...|::..:.||:|:|:
pombe   136 NKGDILNVGSIAGR---ESYVG-GSVYCSTKSALAQFTSALRKET--IDTRIRIMEVDPGLVETE 194

  Fly   201 FL------------SVYSQAVAELPKLQARDVAKAVLYALNTPDGVQVEDIIL 241
            |.            :||..:....|:    |:|:.:|:||...:.|.:.|.::
pombe   195 FSVVRFHGDKQKADNVYKNSEPLTPE----DIAEVILFALTRRENVVIADTLV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 65/248 (26%)
YdfG 9..241 CDD:226674 65/246 (26%)
SPAC521.03NP_593098.1 YdfG 1..249 CDD:226674 65/248 (26%)
SDR_c5 7..256 CDD:187604 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.