DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Hsd17b1

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_036983.1 Gene:Hsd17b1 / 25322 RGDID:2836 Length:344 Species:Rattus norvegicus


Alignment Length:259 Identity:67/259 - (25%)
Similarity:108/259 - (41%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VAVVTGASVGIGATTAIELA---NAGMVVVGLARRVE----LIEALRDQVTGVGKIFARQCDLND 68
            |.::||.|.|||...|:.||   :....|....|.::    |:||.|.|....|.:...:.|:.|
  Rat     5 VVLITGCSSGIGLHLAVRLASDRSQSFKVYATLRDLKSQGPLLEAARAQGCPPGSLEILELDVRD 69

  Fly    69 EEQLASAFNWIREKFQAIHVLICNA-----GILKANFLSESPTKDIKELFDTNVVATASCLREAL 128
            .|.:|:|...:.|  ..:.||:|||     |.|:|:.|:.     :..:.|.||:.|...|:..|
  Rat    70 SESVAAARACVTE--GRVDVLVCNAGRGLFGPLEAHELNA-----VGAVLDVNVLGTIRMLQAFL 127

  Fly   129 KHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSIC 193
            ..|.. :..|.::|..||.|    .:.:|...||.|:|.|:..||:::...:....:::.|.. |
  Rat   128 PDMKR-RHSGRVLVTASVGG----LMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIE-C 186

  Fly   194 PGMVDTDFLSV--------------------------YSQAVAELPKLQARDVAKAVLYALNTP 231
             |.|.|.|...                          |.||::|..  ...:|.:..|.|:..|
  Rat   187 -GAVHTAFHEKLEGGPGGALERADAQTRHLFAHYQRGYEQALSEAQ--DPEEVTELFLTAMRAP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 67/259 (26%)
YdfG 9..241 CDD:226674 67/259 (26%)
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:419666 67/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.