DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Rdh8

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:267 Identity:63/267 - (23%)
Similarity:112/267 - (41%) Gaps:65/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK-------------- 58
            :.:..:::|.|.|||...|::||:      ...:|.:::..:||    :||              
Mouse     4 QQRTVLISGCSSGIGLELALQLAH------DPRQRYQVVATMRD----LGKKEPLEAAAGEALGK 58

  Fly    59 -IFARQCDLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATAS 122
             :...|.|:.::|.:....:.| |..| :.||:.|||:.....|.......::.:|:||......
Mouse    59 TLSVVQLDVCNDESVTDCLSHI-EGGQ-VDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVR 121

  Fly   123 CLREALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNI 187
            .::..|..|.. :.:|||||::||:|.:    .|....||.|:|.|:....:::  .|...:.||
Mouse   122 LVKAVLPGMKR-RRQGHIVVVSSVMGLQ----GVMFNDVYAASKFALEGFFESL--AIQLRQFNI 179

  Fly   188 KLTSICPGMVDTDF----LSVYSQAVAELPKL-------------------------QARDVAKA 223
            .::.:.||.|.|||    |:..|:  ||.|..                         ..||||:.
Mouse   180 FISMVEPGPVTTDFEGKLLAQVSK--AEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQV 242

  Fly   224 VLYALNT 230
            :...:.|
Mouse   243 IAKVIGT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 63/267 (24%)
YdfG 9..241 CDD:226674 63/266 (24%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 63/265 (24%)
adh_short 6..201 CDD:278532 54/213 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.