Sequence 1: | NP_001262831.1 | Gene: | rdhB / 42614 | FlyBaseID: | FBgn0038946 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025461.1 | Gene: | Rdh8 / 235033 | MGIID: | 2685028 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 267 | Identity: | 63/267 - (23%) |
---|---|---|---|
Similarity: | 112/267 - (41%) | Gaps: | 65/267 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGK-------------- 58
Fly 59 -IFARQCDLNDEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATAS 122
Fly 123 CLREALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNI 187
Fly 188 KLTSICPGMVDTDF----LSVYSQAVAELPKL-------------------------QARDVAKA 223
Fly 224 VLYALNT 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdhB | NP_001262831.1 | Mgc4172-like_SDR_c | 4..244 | CDD:187601 | 63/267 (24%) |
YdfG | 9..241 | CDD:226674 | 63/266 (24%) | ||
Rdh8 | NP_001025461.1 | NADB_Rossmann | 6..263 | CDD:304358 | 63/265 (24%) |
adh_short | 6..201 | CDD:278532 | 54/213 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |