DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and R05D8.9

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:240 Identity:67/240 - (27%)
Similarity:112/240 - (46%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQV--TGV--GKIFARQCDLNDEE 70
            |||:|||:|.|||...|:..|..|..|....|..|.:|..|.::  :||  ..:.:...||..|:
 Worm     8 KVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPESHVLSVATDLAAEK 72

  Fly    71 QLASAFNWIREKFQAIHVLICNAGILKANFLSE----SPTKDIK---ELFDTNVVATASCLREAL 128
            ......|...:||..:.:|:.|||   |.|..:    ...:|:.   ::...|:.:..:..::|.
 Worm    73 GQDELVNSTIQKFGRLDILVNNAG---AAFNDDQGRVGVDQDVSVYDKIMQINMRSVVTLTQKAK 134

  Fly   129 KHMAAVKVRGHIVVMNSVLG--HRIPEVPVPLFSVYPATKHAITALCQTVR-QEIHFLKLNIKLT 190
            :|:  ||.:|.||.::|:.|  |..|.|     ..|..:|   :||.|..| ..|..::..:::.
 Worm   135 EHL--VKAKGEIVNVSSIAGTAHAQPGV-----MYYAMSK---SALDQFTRCAAIDLIQYGVRVN 189

  Fly   191 SICPGMVDTDF---LSVYSQAVAELPK-LQARD-------VAKAV 224
            |:.||.|.|.|   :.:.|.|..|:.| :::|.       |||.:
 Worm   190 SVSPGGVTTGFGEAMGMPSGAFEEMMKFMESRKECIPSGAVAKPI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 67/240 (28%)
YdfG 9..241 CDD:226674 67/240 (28%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 67/240 (28%)
NADB_Rossmann 5..266 CDD:304358 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D460854at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.