powered by:
Protein Alignment rdhB and C33E10.10
DIOPT Version :9
Sequence 1: | NP_001262831.1 |
Gene: | rdhB / 42614 |
FlyBaseID: | FBgn0038946 |
Length: | 248 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_510806.1 |
Gene: | C33E10.10 / 183165 |
WormBaseID: | WBGene00016350 |
Length: | 135 |
Species: | Caenorhabditis elegans |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 21/39 - (53%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 LASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIK 110
|...|:.:|.:.:.:|:|:.:||.:...|.|.:...|.|
Worm 23 LQGYFDCLRAEHKNLHILVVSAGYINTGFGSRALNTDGK 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1205 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.