DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and C33E10.10

DIOPT Version :10

Sequence 1:NP_651024.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_510806.1 Gene:C33E10.10 / 183165 WormBaseID:WBGene00016350 Length:135 Species:Caenorhabditis elegans


Alignment Length:39 Identity:11/39 - (28%)
Similarity:21/39 - (53%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIK 110
            |...|:.:|.:.:.:|:|:.:||.:...|.|.:...|.|
 Worm    23 LQGYFDCLRAEHKNLHILVVSAGYINTGFGSRALNTDGK 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_651024.1 Mgc4172-like_SDR_c 4..244 CDD:187601 11/39 (28%)
C33E10.10NP_510806.1 Rossmann-fold NAD(P)(+)-binding proteins <15..115 CDD:473865 11/39 (28%)

Return to query results.
Submit another query.