Sequence 1: | NP_001262831.1 | Gene: | rdhB / 42614 | FlyBaseID: | FBgn0038946 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510793.2 | Gene: | dhs-30 / 181761 | WormBaseID: | WBGene00000993 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 51/199 - (25%) |
---|---|---|---|
Similarity: | 90/199 - (45%) | Gaps: | 22/199 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGKIFARQ-----CDLN 67
Fly 68 DEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMA 132
Fly 133 AVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
Fly 198 DTDF 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdhB | NP_001262831.1 | Mgc4172-like_SDR_c | 4..244 | CDD:187601 | 51/199 (26%) |
YdfG | 9..241 | CDD:226674 | 51/198 (26%) | ||
dhs-30 | NP_510793.2 | NADB_Rossmann | 45..291 | CDD:304358 | 51/199 (26%) |
PRK06181 | 47..290 | CDD:235726 | 51/198 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |