DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and dhs-30

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_510793.2 Gene:dhs-30 / 181761 WormBaseID:WBGene00000993 Length:311 Species:Caenorhabditis elegans


Alignment Length:199 Identity:51/199 - (25%)
Similarity:90/199 - (45%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGKIFARQ-----CDLN 67
            :|||.|:||||.|:|.:.|.||...|..|:.|||..|.::.:.:::.....:...:     .|:.
 Worm    46 KNKVVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICEELKETFPLNQNEPIYYYFDIT 110

  Fly    68 DEEQLASAFNWIREKFQAIHVLICNAGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMA 132
            |.||...|      :...:.:||.|||:.......::..:..::..:||........:..|..::
 Worm   111 DSEQAPWA------EIPRVDILINNAGMSNRGSCQDTTMEIHRQAMETNYFGHVHVTQALLSKLS 169

  Fly   133 AVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMV 197
            .   .|.|||.:|:.|    :|.:|....|.|:|||:......:|.|    ..|:.:..:..|.:
 Worm   170 P---DGCIVVTSSIQG----KVAIPYRGSYGASKHALQGYFDCLRAE----HKNLHILVVSAGYI 223

  Fly   198 DTDF 201
            :|.|
 Worm   224 NTGF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 51/199 (26%)
YdfG 9..241 CDD:226674 51/198 (26%)
dhs-30NP_510793.2 NADB_Rossmann 45..291 CDD:304358 51/199 (26%)
PRK06181 47..290 CDD:235726 51/198 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.