Sequence 1: | NP_001262831.1 | Gene: | rdhB / 42614 | FlyBaseID: | FBgn0038946 | Length: | 248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034605.1 | Gene: | Hsd17b1 / 15485 | MGIID: | 105077 | Length: | 344 | Species: | Mus musculus |
Alignment Length: | 259 | Identity: | 67/259 - (25%) |
---|---|---|---|
Similarity: | 109/259 - (42%) | Gaps: | 54/259 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VAVVTGASVGIGATTAIELA---NAGMVVVGLARRVE----LIEALRDQVTGVGKIFARQCDLND 68
Fly 69 EEQLASAFNWIREKFQAIHVLICNA-----GILKANFLSESPTKDIKELFDTNVVATASCLREAL 128
Fly 129 KHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSIC 193
Fly 194 PGMVDTDF--------------------------LSVYSQAVAELPKLQARDVAKAVLYALNTP 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdhB | NP_001262831.1 | Mgc4172-like_SDR_c | 4..244 | CDD:187601 | 67/259 (26%) |
YdfG | 9..241 | CDD:226674 | 67/259 (26%) | ||
Hsd17b1 | NP_034605.1 | NADB_Rossmann | 4..260 | CDD:304358 | 67/259 (26%) |
adh_short | 5..192 | CDD:278532 | 56/200 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |