DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and Hsd11b1

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus


Alignment Length:217 Identity:53/217 - (24%)
Similarity:97/217 - (44%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVGKIFARQCDLNDEEQL 72
            :.|..:|||||.|||...|..|:..|..||..||..|          |:.|:.:|..:|.     
Mouse    45 QGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEE----------GLQKVVSRCLELG----- 94

  Fly    73 ASAFNWI---REKFQAIHVLICNAG-------ILKANFLSESPTK-------DIKELFDTN---- 116
            |::.::|   .|........|..||       :|..|.::::...       .::.:.:.|    
Mouse    95 AASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSY 159

  Fly   117 -VVATAS--CLREALKHMAAVKVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQ 178
             |::||:  .|:::         .|.|.|::|:.|    ::..|:.:.|.|:|.|:.....|:|.
Mouse   160 VVMSTAALPMLKQS---------NGSIAVISSLAG----KMTQPMIAPYSASKFALDGFFSTIRT 211

  Fly   179 EIHFLKLNIKLTSICPGMVDTD 200
            |::..|:|:.:|....|::||:
Mouse   212 ELYITKVNVSITLCVLGLIDTE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 53/217 (24%)
YdfG 9..241 CDD:226674 53/216 (25%)
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 53/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.