DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdhB and hsd11b1lb

DIOPT Version :9

Sequence 1:NP_001262831.1 Gene:rdhB / 42614 FlyBaseID:FBgn0038946 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_009297199.1 Gene:hsd11b1lb / 100333777 ZFINID:ZDB-GENE-101130-4 Length:281 Species:Danio rerio


Alignment Length:232 Identity:53/232 - (22%)
Similarity:97/232 - (41%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RNKVAVVTGASVGIGATTAIELANAGMVVVGLARRVELIEALRDQVTGVG--KIFARQCDLNDEE 70
            |....::||||.|||...|...|..|..:|..|||:|.::.:..:...:|  ||.....|::|..
Zfish    29 RGTRVLITGASSGIGEQMAYHYAKFGAEIVITARRLEALKKVTQKCEKLGAKKIMYVTGDMSDPA 93

  Fly    71 QLASAFNWIREKFQAIHVLICN-AGILKANFLSESPTKDIKELFDTNVVATASCLREALKHMAAV 134
            .......:..||...:..|:.| .|..... |.......::.|...|.|:.......||..:.. 
Zfish    94 DPERVLKYTIEKLGGLDFLVLNHVGNTNVG-LWNRDADHVRSLMQVNFVSYVQMAGAALPVLET- 156

  Fly   135 KVRGHIVVMNSVLGHRIPEVPVPLFSVYPATKHAITALCQTVRQEIHFLKLNIKLTSICPGMVDT 199
             ..|.|:|::|:.|    ::..|..:.|.:||.|:......:::|:...|.|:.::....|::||
Zfish   157 -SGGSIIVVSSLAG----KIASPFVTPYSSTKFAMNGFFGALQKELAIQKSNVSVSIQILGLIDT 216

  Fly   200 D----------FLSVYSQAVAELPKLQARDVAKAVLY 226
            :          .::.|..:.|.|..::|....:.|.:
Zfish   217 ESAMRKIRGYTTMTAYPASEAALSIIKAGATRQKVAF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdhBNP_001262831.1 Mgc4172-like_SDR_c 4..244 CDD:187601 53/232 (23%)
YdfG 9..241 CDD:226674 52/231 (23%)
hsd11b1lbXP_009297199.1 NADB_Rossmann 28..273 CDD:304358 53/232 (23%)
adh_short 33..226 CDD:278532 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.