DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34377 and inppl1b

DIOPT Version :10

Sequence 1:NP_001262830.1 Gene:CG34377 / 42608 FlyBaseID:FBgn0263117 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001034224.2 Gene:inppl1b / 368433 ZFINID:ZDB-GENE-030616-75 Length:1226 Species:Danio rerio


Alignment Length:148 Identity:41/148 - (27%)
Similarity:61/148 - (41%) Gaps:33/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSAASSCNQPEPLATGVGSSGVSGASGASGASGASTSTKPQRLNKVSFAPLDLPFP--------- 65
            |||:....||.|               |||.:..:.....:.|::|.|.|.|..:|         
Zfish  1089 SSASWIVEQPTP---------------ASGDNSLTALQIAKSLSEVDFQPADKKYPFHQMPSQQR 1138

  Fly    66 -----SGATXYANAN--ASTSMPH--HNIVCEWLRTIGLAHYGESFLENGYDELEICKQIGEIDL 121
                 .|.....|.:  ...|:.|  ...|.|.|.|:||..|......:|:|:|:....|.|.:|
Zfish  1139 QHGYDYGLASERNYSWEKEVSVLHGAPETVRELLSTLGLQRYTLDLSRSGWDDLDYFSGITEEEL 1203

  Fly   122 DAIGVDNPSHRGKLLKSV 139
            .|.||.|||||.::|:::
Zfish  1204 CAAGVSNPSHRRRILENL 1221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34377NP_001262830.1 SAM_superfamily 84..144 CDD:472832 22/56 (39%)
inppl1bNP_001034224.2 SH2_SHIP 2..104 CDD:198206
EEP 404..707 CDD:469791
SAM_superfamily 1165..1221 CDD:472832 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.