DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34377 and INPPL1

DIOPT Version :10

Sequence 1:NP_001262830.1 Gene:CG34377 / 42608 FlyBaseID:FBgn0263117 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001427363.1 Gene:INPPL1 / 3636 HGNCID:6080 Length:1280 Species:Homo sapiens


Alignment Length:162 Identity:42/162 - (25%)
Similarity:63/162 - (38%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PEPLATGVGSSGVSGASGASGASGASTSTKPQRLNKVSFA------------PLDLPFPSGATXY 71
            |.|.:|.:|..    |||..  ...|.....:.|::|.:|            ||:|..|.|..  
Human  1125 PSPASTFLGEV----ASGDD--RSCSVLQMAKTLSEVDYAPAGPARSALLPGPLELQPPRGLP-- 1181

  Fly    72 ANANASTSMPHHNI---------------------------VCEWLRTIGLAHYGESFLENGYDE 109
            ::.....|.|...|                           :..|||.|||..|.|..:.||:|:
Human  1182 SDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDD 1246

  Fly   110 LEICKQIGEIDLDAIGVDNPSHRGKLLKSVRM 141
            ||....|.|.||:..||.:|:|:..||.::::
Human  1247 LEFLSDITEEDLEEAGVQDPAHKRLLLDTLQL 1278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34377NP_001262830.1 SAM_superfamily 84..144 CDD:472832 24/85 (28%)
INPPL1NP_001427363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 919..1140 7/18 (39%)
SH3-binding 966..971
NPXY motif 1005..1008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.