DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34377 and Samd5

DIOPT Version :10

Sequence 1:NP_001262830.1 Gene:CG34377 / 42608 FlyBaseID:FBgn0263117 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_017169459.1 Gene:Samd5 / 320825 MGIID:2444815 Length:182 Species:Mus musculus


Alignment Length:148 Identity:54/148 - (36%)
Similarity:78/148 - (52%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NIVCEWLRTIGLAHYGESFLENGYDELEICKQIGEIDLDAIGVDNPSHRGKLLKSVRMLREKGAA 148
            |||.|||:.:.|..|.|||::||||:||:|||||:.|||||||..|:||.::|::|..|||:.||
Mouse     4 NIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRLREQDAA 68

  Fly   149 ---IVYVLINDP----------------KALSSSNEILASD--------CDTPVT---MKELEAV 183
               :.:.|...|                :...||.:....|        |...:.   ..:|:.:
Mouse    69 AAGLYFTLEPQPVPPAPLVEAVPPGRRGEPCGSSAQGTRGDPRGQPGAPCSRELVSYPKLKLKIM 133

  Fly   184 MKRHLEADGIRLTAHPYS 201
            ::..|..|||.|:..|||
Mouse   134 IRDKLVRDGIHLSKPPYS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34377NP_001262830.1 SAM_superfamily 84..144 CDD:472832 35/59 (59%)
Samd5XP_017169459.1 SAM_Samd5 2..64 CDD:188926 35/59 (59%)

Return to query results.
Submit another query.