DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34377 and Inppl1

DIOPT Version :10

Sequence 1:NP_001262830.1 Gene:CG34377 / 42608 FlyBaseID:FBgn0263117 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_034697.2 Gene:Inppl1 / 16332 MGIID:1333787 Length:1257 Species:Mus musculus


Alignment Length:160 Identity:42/160 - (26%)
Similarity:61/160 - (38%) Gaps:42/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PLATGVGSSGVSGASGASGAS-GASTSTKPQRLNKVSFA-----------PLDLPFPSGATXYAN 73
            ||..|...:.......|||.. ..|.....:.|::|.:|           ||:|..|.|.:.|..
Mouse  1099 PLPPGTSPASTFLGEVASGDDRSCSVLQMAKTLSEVDYAPGPGRSALLPNPLELQPPRGPSDYGR 1163

  Fly    74 ANASTSMPHHNI---------------------------VCEWLRTIGLAHYGESFLENGYDELE 111
               ..|.|...|                           :..|||.|||..|.|..:.||:|:||
Mouse  1164 ---PLSFPPPRIRESIQEDLAEEAPCPQGGRASGLGEAGMGAWLRAIGLERYEEGLVHNGWDDLE 1225

  Fly   112 ICKQIGEIDLDAIGVDNPSHRGKLLKSVRM 141
            ....|.|.||:..||.:|:|:..||.::::
Mouse  1226 FLSDITEEDLEEAGVQDPAHKRLLLDTLQL 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34377NP_001262830.1 SAM_superfamily 84..144 CDD:472832 24/85 (28%)
Inppl1NP_034697.2 SH2_SHIP 17..119 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..181
INPP5c_SHIP2-INPPL1 425..728 CDD:197335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..986
SH3-binding 945..950
NPXY motif 984..987
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1119 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1134..1196 11/64 (17%)
SAM_Ship2 1193..1255 CDD:188890 23/61 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.