DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34377 and inppl1a

DIOPT Version :10

Sequence 1:NP_001262830.1 Gene:CG34377 / 42608 FlyBaseID:FBgn0263117 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_031753288.1 Gene:inppl1a / 100485745 XenbaseID:XB-GENE-1013837 Length:1280 Species:Xenopus tropicalis


Alignment Length:70 Identity:28/70 - (40%)
Similarity:44/70 - (62%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YANANASTSMPHHNIVCEWLRTIGLAHYGESFLENGYDELEICKQIGEIDLDAIGVDNPSHRGKL 135
            |....:|:|: ..:.|.||||.|||..|.|..::||:|:||....|.|.||:..||.:|:|:..:
 Frog  1209 YQGGRSSSSL-RESSVGEWLRAIGLERYEEGLIQNGWDDLEFLSDIVEEDLEEAGVLDPTHKRVI 1272

  Fly   136 LKSVR 140
            |:|::
 Frog  1273 LESLQ 1277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34377NP_001262830.1 SAM_superfamily 84..144 CDD:472832 25/57 (44%)
inppl1aXP_031753288.1 SH2_SHIP 15..117 CDD:198206
EEP 414..717 CDD:469791
SAM_superfamily 1223..1277 CDD:472832 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.