DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and Slc22a17

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001347335.1 Gene:Slc22a17 / 59049 MGIID:1926225 Length:520 Species:Mus musculus


Alignment Length:508 Identity:112/508 - (22%)
Similarity:187/508 - (36%) Gaps:119/508 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FSNCEMFQMNFSEITDWSAWNSNLTKTTEA-------CQNGWSYDKTWYESTIPTDHNWVCAKDL 170
            |::|         :.||. :|.....||.|       |..||.                |..:.:
Mouse    67 FNHC---------LKDWD-YNGLPVLTTNAIGQWDLVCDLGWQ----------------VILEQI 105

  Fly   171 FVTNVFVVGRVTEVAGSFILGQMGDSYGRRFVYYISVVFCSLGRLGSI----MCTSSYTWFLIMS 231
                :|::|   ..:|...||...|.:|||     .:|..:||.:|..    ....|.|..:.:.
Mouse   106 ----LFILG---FASGYLFLGYPADRFGRR-----GIVLLTLGLVGPCGVGGAAAGSSTGIMALR 158

  Fly   232 GIVGLTVNSLFQSPQIIGMEISREEDRSRIAFFQSCGWSIGTTLMPLLYWWLRHWDSFMWLTSIP 296
            .::|..:..:.....::.:|:.....|.|:|.........|..|...|....:.|   .:|..:.
Mouse   159 FLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGELVGVGGHFLFLGLALVSKDW---RFLQRMI 220

  Fly   297 TAMVLLFSKY-----VIESPRWLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYSRDKQDV 356
            ||..:||..|     .:||.||||.|::..||...|:.:|:.|.....|..:|..|.....:...
Mouse   221 TAPCILFLFYGWPGLFLESARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQELENTC 285

  Fly   357 ------TYGIASLFAGWRLARNTTIMGFS--------WCVVAVSYFTLVLFSSRMAGNPFLNFLY 407
                  |:..|||.....:.:|..|:||:        .|...|.          ..|:|...:|.
Mouse   286 PLPATSTFSFASLLNYRNIWKNLLILGFTNFIAHAIRHCYQPVG----------GGGSPSDFYLC 340

  Fly   408 QSIVEIPAYVVGRYMG---DTYGRRFTNSVSFLISFVTCLPIIVYSTDERYENLMIYLATFIKFL 469
            ..:....|.:...::|   |.:|||....:|..::.:..|.::         .|..||..     
Mouse   341 SLLASGTAALACVFLGVTVDRFGRRGILLLSMTLTGIASLVLL---------GLWDYLND----- 391

  Fly   470 NALTFFTV-------------NLQCLEIYPTCMRQTGVALGTILA-NAIGVLA--PYLVYLGTTV 518
            .|:|.|:|             .|...|:.||.:|  |..||.|:| .|:|.|:  ...:::|...
Mouse   392 AAITTFSVLGLFSSQASAILSTLLASEVIPTTVR--GRGLGLIMALGALGGLSCPAQRLHMGHGA 454

  Fly   519 DIRAPYYILGVLFLLGGIGALFLPETLHKKLPDTMEEAGHFGKHDKFFSLPKP 571
            .::  :.:|....||..:..:.||||..|.||:.:.: |...:.......|.|
Mouse   455 FLQ--HVVLAACALLCILSIMLLPETKRKLLPEVLRD-GELCRRPSLLRQPPP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 109/487 (22%)
MFS 184..542 CDD:119392 88/399 (22%)
Slc22a17NP_001347335.1 MFS_SLC22A17 63..476 CDD:341003 102/477 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.