DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and CG31103

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:482 Identity:98/482 - (20%)
Similarity:180/482 - (37%) Gaps:119/482 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LTKTTEACQNGWSY----DKTWYESTIPTDHNWVCAKDLFVTNVFVVGRVTEVAGSFILGQMGDS 196
            ||.|:.|.|...|.    .:..:|:|.......:.|.   ||.:|:        .::|.|.:.|.
  Fly    40 LTITSVAAQQAMSIIVIASQCEFETTQAEKGVMMAAS---VTGIFL--------STYIWGYISDD 93

  Fly   197 YGRRFVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGIVGLTVNSLFQSPQIIGMEISREEDRSRI 261
            .|||.|.... .|.|......:|..:|...|.|::.:||::|.::..:......|.:....|:..
  Fly    94 IGRRRVLLYG-NFASNALQFVLMFVTSVWLFNIINLLVGISVGAVSAALYAYLSEFNIPRHRAVA 157

  Fly   262 AFFQSCGWSIGTTLMPLLYW------W--------LRHWDSFMWLTSIPTAMVLLFSKYVIESPR 312
            ..:.:...|:....:|...|      |        .|.|...:.::.:|..:..|...|..|||:
  Fly   158 INYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRLLLLVSLLPGFIGGLILLYYPESPK 222

  Fly   313 WLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYSRDK---------------QDVTYGIAS 362
            :|:|:::..|||..:..|:|.|      ..|.:.::.|.|:               :....||.|
  Fly   223 FLLSQEKNNEAIEAVAWISKFN------RGKSIQQVLSCDEFTLKSEDPVGENLLGESQGCGILS 281

  Fly   363 LFAGWRLARNTTIM-----GFSWCVVAVSYFTLVLFSSRMAGNPFLNFLYQSIVEIPAYVVGRYM 422
                 ::.|.|..:     ||::.:..::.|.:...|:.|.            :..|. :|.|..
  Fly   282 -----KICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQ------------LWFPE-IVNRSS 328

  Fly   423 GDTYGRRFTNSVSFLISFVTCLPIIVYSTD-------ERY-ENLMIYLATFIKF------LNALT 473
            |   ....:::|..::|.....|.:..:.|       :.| :||::..|..|.|      ||.|.
  Fly   329 G---AENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPLG 390

  Fly   474 FFTVNLQCLEIYPTCMRQTGVAL-------GTILANAIGVLAPYL---VYLGTTVDIRAPYYI-- 526
            ...|.|..|.:    ...:||.|       |.::...:.:|.|.|   :.:|..||: .|.::  
  Fly   391 RKNVLLAALAV----ATLSGVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAIVDL-VPTHLRS 450

  Fly   527 -----------LGVLFLLGGIGALFLP 542
                       ||::.....:|.:..|
  Fly   451 KAVSFCMSLGRLGIIAATNLMGVMLQP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 98/482 (20%)
MFS 184..542 CDD:119392 85/428 (20%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 97/478 (20%)
MFS 34..>189 CDD:119392 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.