DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and CG12783

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:461 Identity:83/461 - (18%)
Similarity:141/461 - (30%) Gaps:160/461 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VAGSFILGQMGDSYGRRFVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGI----------VGLTV 238
            :..|:..|.:.|..|||:....::...:|..|.| |.|.::|.|.:|..|          |..|.
  Fly    68 ICSSYFWGYITDKKGRRWTLLRTITISNLCSLAS-MFTVTFTGFFVMRFITCIFVAGPSFVAATY 131

  Fly   239 NSLFQSPQIIGMEISREEDRSRIAFFQSCGWS---------------IGTTLMPLLYWWLRHWDS 288
            .|.|.|.:|:...|:.....:..|......|:               :|:..       ||.|..
  Fly   132 LSEFCSHRIMVRSITHLYMFTGFAMISCPAWATLFLSSGLIEFEEKLVGSLT-------LRPWRV 189

  Fly   289 FMWLTSIPTAMVLLFSKYVIESPRWLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYS--- 350
            ...|..:|..:..|....:.|||::|:.....:..:..::.|::.|..| .::|.::..:.:   
  Fly   190 LGCLYILPGVVAFLLLLLLPESPKFLLMIGETKRGLDTMEWISRKNTGR-TLSEDQMKRLLAYQE 253

  Fly   351 -----RDKQDVTYGIASLFAGWRLARNTTIMGFSWCVVAVSY----------------------- 387
                 |.|:...:..:.|.....|.|. ...|:..||..|.:                       
  Fly   254 HVQVKRRKEHQNFFRSMLDDAMPLVRK-PYGGYFTCVCMVMFVLGLLTHGLGIWYTAMRNRCNMR 317

  Fly   388 --------FTLVLFSSRMAGNPF-----------------------LNFLYQSIVEIP------- 414
                    |..|||....  .||                       |.|:|..:..|.       
  Fly   318 QGNTNGMTFCQVLFVPET--GPFIETESDLDVVCSDSFKGFNDSFVLGFVYVVLYNISWASLFCV 380

  Fly   415 ----AYVVGRYMGDTYGRRFTNSVSFLISFVTCLPIIVYSTDERYENLMIYLATFIKFLNALTFF 475
                .:|.......|:|        ||:.|.|              |.|:.|.:.: ||.|....
  Fly   381 HKKVMFVFSLVASSTFG--------FLLIFAT--------------NHMLQLFSLV-FLIAFPGI 422

  Fly   476 TVNL---QCLEIYPTCMR-----------QTGVALGTILANAIGVLAPYLVYLGTTVDIRAPYYI 526
            .:.|   ..|...||.:|           :.|.|.|.:|             :|:.:......::
  Fly   423 IIGLLGGSLLVFVPTYLRGKALCISLMWCRCGAAFGAML-------------VGSKIQYNCELFL 474

  Fly   527 LGVLFL 532
            |.:..|
  Fly   475 LAISIL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 83/461 (18%)
MFS 184..542 CDD:119392 83/461 (18%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 48/251 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.