DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and CG14691

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster


Alignment Length:479 Identity:104/479 - (21%)
Similarity:179/479 - (37%) Gaps:126/479 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 CAKDLFVTNVFVVGRVTEVAGSFI----LGQMGDSYGRRFVYYISVVFCSLGRLGS--IMCTS-- 222
            |..||.:.:..::..|| .||..|    .|.:.|:.|||      .|..|.|.|..  ::|.|  
  Fly    58 CDLDLSIVDKGMLHAVT-YAGMIISAVPWGFIADTIGRR------PVLISGGWLDGFFVLCASLS 115

  Fly   223 -------SYTWF--LIMSGIVGLTVNSLFQSPQIIGMEISREEDRSRIAFFQSCGWSIGTTLMPL 278
                   ::.:|  ||:.|...:.|:.|        .|...::.|..|..|.....|||:.::||
  Fly   116 QNTAQLMAFKFFDGLIICGPFAVVVSYL--------AEFHGKKHRPYIMLFVGLCVSIGSMILPL 172

  Fly   279 LYWWL--------------RHWDSFMWLTSIPTAMVLLFSKYVIESPRWLISKQRFREAIVQLQK 329
            |.:.|              |.|..|:.::|.|:.:......::.|||::|:|:..:::|:..||:
  Fly   173 LSYLLLPVPILFTVSSMKFRTWQVFLAVSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQR 237

  Fly   330 IAKIN----------GHRFDMT------------EKELAEIYSRDKQDVTYGIASL---FAGWRL 369
            |.|:|          .|..|.|            ...|.|.:||.:.....|...|   |:...|
  Fly   238 IYKLNKRKSRESYPIKHLTDPTPDRSDDLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYL 302

  Fly   370 ARNTTIMGFSW----CVVAVSYFTLVLFSSRMAGNPF------------LNFLYQSIVEIPAYV- 417
            |.:..:....:    ||.:|..:...:|::..|.:..            .|...:|:.|....| 
  Fly   303 AISLQVYCLHFCQIMCVNSVRLWLPQIFATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVE 367

  Fly   418 -VGRYMGDTYGRRFTNSVSFLISFVTCLPIIVYSTDERYENLMIYLATFIKFLNALTFFTVNL-- 479
             ...:..|:|....|.:...|:.|:...|::.:.....: .|.::|...|..:.:|.|...:|  
  Fly   368 CALHHDPDSYLNNITVAGIGLVGFLIIFPLMRFQVVSNH-ILKVFLFICIFLVGSLYFVKTSLVT 431

  Fly   480 --------------------QCLEIYPTCMR-------QTGVALGTILANAIGVLAPYLVYLGTT 517
                                ..:.|:||.||       .|...||::..|   :|.|..:.|...
  Fly   432 MMVSAVYLTMMGICATTIIGMSVVIFPTLMRTMVLLLIMTFGRLGSVSGN---MLLPVFMQLSCL 493

  Fly   518 VDIRAPYYILGVLFLLGGIGALFL 541
                ||:..|..|..:..:.:|||
  Fly   494 ----APFLWLCSLMSIAFLFSLFL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 104/479 (22%)
MFS 184..542 CDD:119392 99/461 (21%)
CG14691NP_650012.2 MFS 30..>216 CDD:119392 41/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.