DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and CG14691

DIOPT Version :10

Sequence 1:NP_651016.1 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster


Alignment Length:35 Identity:11/35 - (31%)
Similarity:17/35 - (48%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 RTNLSLHKCFVRYEDDFGSFWMVDDHEFLKRRHLS 354
            ||:..|.|...:..:.||.  ..||.|..:|.|::
  Fly   155 RTDTKLPKVSTKEVEKFGE--QSDDEERHERSHIA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_651016.1 MFS_SLC22 146..542 CDD:340875 11/35 (31%)
CG14691NP_650012.2 synapt_SV2 2..>337 CDD:130366 11/35 (31%)
MFS <375..513 CDD:475125
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.