DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and SLC22A10

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001034841.3 Gene:SLC22A10 / 387775 HGNCID:18057 Length:541 Species:Homo sapiens


Alignment Length:575 Identity:142/575 - (24%)
Similarity:246/575 - (42%) Gaps:83/575 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FQALMEKAGNHGRYQTLYNFVFVGGLAFSGAMIYMNIILALN----IPDHWC--------TVPGR 86
            |:.|:.:.|..||:|.|: .||:    ....|:.:..||..|    ||.|.|        |..|.
Human     3 FEELLSQVGGLGRFQMLH-LVFI----LPSLMLLIPHILLENFAAAIPGHRCWVHMLDNNTGSGN 62

  Fly    87 ENTNFSLEEWRDITLPKQADNRGRKTFSNCEMFQMNFSEITDWSAWNSNLT------KTTEACQN 145
            |....|.:....|::|..::.|..|    |..|..     ..|...:.|.|      ..||.|.:
Human    63 ETGILSEDALLRISIPLDSNLRPEK----CRRFVH-----PQWQLLHLNGTIHSTSEADTEPCVD 118

  Fly   146 GWSYDKTWYESTIPTDHNWVC--------AKDLFVTNVFVVGRVTEVAGSFILGQMGDSYGRRFV 202
            ||.||::::.|||.|..:.||        .:.|.:|.:.|        |..|.|.:.|.:||||:
Human   119 GWVYDQSYFPSTIVTKWDLVCDYQSLKSVVQFLLLTGMLV--------GGIIGGHVSDRFGRRFI 175

  Fly   203 YYISVVFCSLGRLGSIMCTS---SYTWFLIMSGIVGLTVNSLFQSPQIIGMEISREEDRSRIAFF 264
                :.:|.|....:..|.:   ::..:.::..:.|.:...:..:..:...|..|...::.:...
Human   176 ----LRWCLLQLAITDTCAAFAPTFPVYCVLRFLAGFSSMIIISNNSLPITEWIRPNSKALVVIL 236

  Fly   265 QSCGWSIGTTLMPLLYWWLRHWDSFMWLTSIPTAMVLLFSKYVIESPRWLISKQRFREAIVQLQK 329
            .|...|||..::..|.:..|.|.:...:.|:|..:..|.|::::||.||||...:..|.:..|:|
Human   237 SSGALSIGQIILGGLAYVFRDWQTLHVVASVPFFVFFLLSRWLVESARWLIITNKLDEGLKALRK 301

  Fly   330 IAKINGHR-------FDMTEKELAEIYSRDKQDVTYGIASLFAGWRLARNTTIMGFSWCVVAVSY 387
            :|:.||.:       .::....:.|  ..|.......:..||....:.:...|:.|......:.:
Human   302 VARTNGIKNAEETLNIEVVRSTMQE--ELDAAQTKTTVCDLFRNPSMRKRICILVFLRFANTIPF 364

  Fly   388 FTLVLFSSRMAGNPF-LNFLYQS---IVEIPAYVVGRYMGDTYGRRFTNSVSFLISFVTCLPIIV 448
            :..::....:..|.| |..||.:   ||...|.:...:|    |||.:   ..|..|:..|.|:.
Human   365 YGTMVNLQHVGSNIFLLQVLYGAVALIVRCLALLTLNHM----GRRIS---QILFMFLVGLSILA 422

  Fly   449 YS-TDERYENLMIYLATFIKFLNALTFFTVNLQCLEIYPTCM--RQTGVALGTILANAIG-VLAP 509
            .: ..:..:.|.:.||......:|.||.:|.:..:|:.||.:  |.:|:.|   .|:.|| .|||
Human   423 NTFVPKEMQTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDL---TASRIGAALAP 484

  Fly   510 YLVYLGTTVDIRAPYYILGVLFLLGGIGALFLPETLHKKLPDTMEEAGHFGKHDK 564
            .|:.| |......|:.|.|:..::||:....||||.:..||||:::..:..|:.|
Human   485 LLMTL-TVFFTTLPWIIYGIFPIIGGLIVFLLPETKNLPLPDTIKDVENQKKNLK 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 129/531 (24%)
MFS 184..542 CDD:119392 86/375 (23%)
SLC22A10NP_001034841.3 2A0119 11..526 CDD:273328 136/553 (25%)
MFS 143..516 CDD:119392 89/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.