DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and CG4324

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:465 Identity:106/465 - (22%)
Similarity:197/465 - (42%) Gaps:76/465 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 NSNLTKTTEACQN----GWSYDK-------TWYESTIPTDHNWVCAKDLF------------VTN 174
            |.:.|.|.:...|    ||.:.|       .|...::......:....||            ||.
  Fly    35 NPDDTYTVQQAINAFGFGWFHVKLSLLVGLCWMSDSMEMAILSILGPSLFCEWNVTKFQQASVTT 99

  Fly   175 VFVVGRVTEVAGSFILGQMGDSYGRR---FVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGIVGL 236
            |..:|.:  ::.|| ..|:.:.|||:   .::.:.:|..|:  |.|:  ..||.|.|.:.|:||.
  Fly   100 VVFLGMM--LSSSF-WTQLSNRYGRKSALTLFGVLLVLYSI--LSSV--APSYAWLLTLRGLVGF 157

  Fly   237 TVNSLFQSPQIIGMEISREEDRSRIAFFQSCGWSIGT---TLMPLLYWWLRHWDSFMWLTSIPTA 298
            .:..:.||..:.. |....:.:.:......|.|::|.   .::.|:.:....|...:.|::.|..
  Fly   158 AIGCVPQSVTLYA-EFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLL 221

  Fly   299 MVLLFSKYVIESPRWLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYSRDKQDVTYGIASL 363
            :..:.|.::.||.|:........:||..|::||. |..|..:..:.:|:    |:........||
  Fly   222 IFTILSPWLSESARYYSYNGHNDKAIKVLEQIAH-NNKRHMLMGRLMAD----DEPSCAESFRSL 281

  Fly   364 FAGWRLARNTTIMGFSWCVVAVSYFTLVLFSSRM--AGN--------------PFLNFLYQSIVE 412
            .:. .|.|.|.::.|.|...|..|:.|||.::.:  |.|              .|::.|:.::.|
  Fly   282 LSP-SLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNKESHPNECVTFMTSDFMDLLWITLSE 345

  Fly   413 IPAYVVGRYMGDTYGRRFTNSVSFLISFVTCLPIIVYSTDERYE---NLMIYLATFIKFLNALTF 474
            .|..::...:...:|::.|..:.:| :.|.| .:::.|.:.|:.   .|.|...|......|:..
  Fly   346 FPGILLTIKVVKLFGKKKTIVLQYL-ALVLC-TLVLMSVESRFSTSVTLFIARGTISGIFQAIYV 408

  Fly   475 FTVNLQCLEIYPTCMRQTGVALGTILANAIGVLAPYLVYL---GTTVDIRAPYYILGVLFLLGGI 536
            :|.     ||||..:|..||:..::||....:|.|::..:   .:.:...:.|.|:|   ||..|
  Fly   409 YTP-----EIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTYAIVG---LLASI 465

  Fly   537 GALFLP-ETL 545
            ..:||| ||:
  Fly   466 ACVFLPRETV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 106/465 (23%)
MFS 184..542 CDD:119392 88/385 (23%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 106/465 (23%)
MFS 60..471 CDD:119392 95/434 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.