DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and CG33233

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:448 Identity:88/448 - (19%)
Similarity:162/448 - (36%) Gaps:116/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VAGSFILGQMGDSYGRRFVYYISVVFCSLGRLGSIMCTSSYTWFLI-------MSGIVGLTVNSL 241
            ||....:|.:.|.|||:||..:::|......:.|.:....|:..:|       :|.:..|.|..|
  Fly    70 VASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFL 134

  Fly   242 FQSPQIIGMEISREEDRSRIAFFQSCGWSIGTTLM--PLL---------------YWWLRHWDSF 289
            .:...|....|:       :|.   |..|.|..|:  ||:               .:.||.|...
  Fly   135 GEFHAIKWRPIT-------VAI---CSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFL 189

  Fly   290 MWLTSIPTAMVLLFSKYVIESPRWLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYS--RD 352
            |....||..:.|:....|.|:|.:|:|..|..:|::.|:.|.::|..:::..:..|:|..|  .|
  Fly   190 MMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTND 254

  Fly   353 KQ----DVTYGIASLFAGWRLARNTTIMGFSWCVVAV--SYFTLVLF--------------SSRM 397
            ::    .|.|....||:      ...:..|..|:..:  .:||.:..              |:|:
  Fly   255 QEGFWKTVWYEYKLLFS------KPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRL 313

  Fly   398 A----GNP-FLNF-------------------------LYQSIVEIPAYVVGRYMGDTYGRRFTN 432
            .    .|| |:|.                         :|.....|..:::...:.....|::..
  Fly   314 CDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVI 378

  Fly   433 SVSFLISFV----------TCLPIIVYSTDERYENLMIYLATFIKFLNALTFFTVNLQCLEIYPT 487
            ::..|||.:          ..:.:|.:........::|.|||           :|.:.||   |.
  Fly   379 ALHILISMILGISLNIMKQPTVVLIFFVLMMVLPGVLIPLAT-----------SVLVDCL---PV 429

  Fly   488 CMRQTGVALGTILANAIGVLAPYLVYLGTTVDIRAPYYILGVLFLLGGIGALFLPETL 545
            .:|...:.:...||...|||...::.|...|.....:.|..:...:..:.|:|.|:.:
  Fly   430 NLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQPKDI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 88/448 (20%)
MFS 184..542 CDD:119392 87/443 (20%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 82/410 (20%)
MFS 23..>208 CDD:119392 33/147 (22%)
MFS 354..>482 CDD:304372 24/141 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.