DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and T05A1.5

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:265 Identity:58/265 - (21%)
Similarity:105/265 - (39%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 WYESTIPT-DHNWV-----CAKD--LFVT--NVFVV-------GRVTE---VAGSFILGQM---- 193
            |..|.:|| ..:::     |..|  .|||  |.|.:       |.:|.   ..|:.||||:    
 Worm    94 WLLSVMPTMSPSYMAPSSPCTLDNCSFVTVQNEFNITKTLIDPGEMTSSIFFLGNGILGQIYAVA 158

  Fly   194 GDSYGRRFVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGIVG-LTVNSLFQSPQIIGMEISREED 257
            .|..|||.|...|:....|..:|:....:    |.||  ::| ....|.|.:..:|...:..|. 
 Worm   159 ADRIGRRPVLIASLFISGLSGIGAAYAPT----FEIM--LIGRFFQGSCFTALTMINWVMCCES- 216

  Fly   258 RSRIAF---------FQSCGWSIGTTLMPLLYWWLRHWDSFMWLTSIPTAMVLLFSKYVI-ESPR 312
               |:|         |..| |.||...:..|..:...|......||:|..:..:...:.: ||..
 Worm   217 ---ISFSGHGYASVLFGLC-WVIGYCSVSPLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFS 277

  Fly   313 WLISKQRFREAIVQLQKIAKINGHRFDMTEKELAEIYSR--DKQDVTYGIASLFAGWRLARNTTI 375
            :|::|::..:.:..::..:::.....|....::.::.||  |.:.:...:..:.....:..||.:
 Worm   278 FLVAKRKRDDLVKWIEMASRVGNEEIDYDADQIVDMSSREEDNESLLQTLKLVLQSKLMVTNTAV 342

  Fly   376 MGFSW 380
            ..|.|
 Worm   343 ETFLW 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 58/265 (22%)
MFS 184..542 CDD:119392 45/214 (21%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 40/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.