DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and B0252.3

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001021888.1 Gene:B0252.3 / 174130 WormBaseID:WBGene00015088 Length:484 Species:Caenorhabditis elegans


Alignment Length:413 Identity:120/413 - (29%)
Similarity:196/413 - (47%) Gaps:39/413 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ESTIPTDHNWVCAKDLFVTNVFVVGRVTEVAGSFILGQMGDSYGRRFVYYISVVFCSLGRLGSIM 219
            |..:..|.:|:...   .|..::||.:  :.|.|| ..:.|.|||..|:..:|:..::|.:.|..
 Worm    82 EFDLTGDASWLAES---TTTFYMVGNM--IGGMFI-PPLADHYGRLPVFVATVLLMAVGGMISAF 140

  Fly   220 CTSSYTWFLIMSGIVGLTVNSLFQSPQIIGMEISREEDRSRIAFFQS----CGWSIGTTLMPLLY 280
            .| |...|.||..|.|:    .:.:..:.|..:..|....|:.||.|    ..|.:|...:.||.
 Worm   141 ST-SIMMFCIMRMIHGI----FYTAAGLAGWVLGYENTPLRLRFFTSVYFGVMWVVGACFLGLLA 200

  Fly   281 WWLRHWDSFMWLTSIPTAMV-LLFSKYVIESPRWLISKQRFREAIVQLQKIAKINGHRFDMTEKE 344
            :.|..|...|:..|:|...| ||....|.||..:|:|.|:..:....|:   ||.|.:.|::..:
 Worm   201 YILPDWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEKIEAWLE---KIRGPKGDISASD 262

  Fly   345 LAEIYSRDKQDVTYGIA-------SLFAGWRLARNTTIMGFSWCVVAVSYFTLVLFSSRMAGNPF 402
            :.|  .||:...::...       .:|..:.|     :|.:.|.|....||.|..:|:.:|||.:
 Worm   263 IVE--DRDENGSSFKTLCREMWKHKMFIVYVL-----VMTYIWIVDTFIYFGLAFYSTNLAGNLY 320

  Fly   403 LNFLYQSIVEIPAYVVGRYMGDTYGRRFTNSVSFLISFVTCLPIIVYSTDERYENLMIYLATFIK 467
            |||:..|:||.|||:......:.|||:...|.:.:|:.::.|.|::.|     |...|:.....|
 Worm   321 LNFVLMSLVEAPAYIFSPIFMNKYGRKVLISGTHIIAGLSFLGIVLSS-----EAWHIHFWLLGK 380

  Fly   468 FLNALTFFTVNLQCLEIYPTCMRQTGVALGTILANAIGVLAPYLVYLGTTVDIRAPYYILGVLFL 532
            |..:.:|.::.:...||:||..|...:.....|:...|:|:|||.:| |.|...||...|.::.:
 Worm   381 FAISCSFMSIYMFASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSHL-TAVHALAPAITLSLIAV 444

  Fly   533 LGGIGALFLPETLHKKLPDTMEE 555
            .||:..|.|||||:.|||.|:.|
 Worm   445 SGGLLTLILPETLNTKLPSTIAE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 118/408 (29%)
MFS 184..542 CDD:119392 104/369 (28%)
B0252.3NP_001021888.1 MFS 87..454 CDD:119392 109/393 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.