DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and UST4r

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_599206.2 Gene:UST4r / 171397 RGDID:620976 Length:552 Species:Rattus norvegicus


Alignment Length:580 Identity:142/580 - (24%)
Similarity:238/580 - (41%) Gaps:93/580 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FQALMEKAGNHGRYQTLYNFVFVGGLAFSGAMIYMNIIL---ALNIPDHWCTVPGRENTNFSLEE 95
            ||.|:.:.|..||:|.| ..|||   .|:..::..:||:   ...||.|.|.||..:|...|..:
  Rat     3 FQELLNQVGGLGRFQIL-QMVFV---VFTSVIVVPHIIIENFTAAIPSHRCWVPILDNVTVSDND 63

  Fly    96 WR--------DITLPKQADNRGRKTFSNCEMFQMNFSEITDWSAWNSNLTK-TTEACQNGWSYDK 151
            .|        .|::|..:..|    ...|..|......:.|.:...|::|: .||.|.:||.||:
  Rat    64 SRILNQDKLLKISIPLDSHLR----LDKCRRFAQPQWHLLDLNDTFSSITEPDTEPCVDGWVYDR 124

  Fly   152 TWYESTIPTDHNWVCAKDLF--VTNV-FVVGRVTEVAGSFILGQMGDSYGRRFVYYISV------ 207
            :.:.||..|:.|.||.....  ||.: |::|   ...|..:.|.:.|.:||:|:...::      
  Rat   125 SNFHSTTVTEWNLVCESQALNSVTKLSFMIG---AFIGGIVNGLLSDRFGRKFILKYALLQMAIT 186

  Fly   208 -----------VFCSLGRLGSIMCTSSYTWFLIMSGIVGLTVN---SLFQ--SPQIIGMEISREE 256
                       ::|||.             ||....:..:|||   .:|:  ||:.:.|      
  Rat   187 ETCAGFAPNLFIYCSLR-------------FLAGMSLEPITVNINLLMFEWTSPKFLTM------ 232

  Fly   257 DRSRIAFFQSCGWSIGTTLMPLLYWWLRHWDSFMWLTSIPTAMVLLFSKYVIESPRWLISKQRFR 321
                :....||..|.|..::..|.:..::|.......|:|....|:.::::.||.||||...:.:
  Rat   233 ----VTVLGSCAGSFGGMILAGLAFQFQNWHHLQLAMSVPIFFFLILTRWLSESARWLIVINKPQ 293

  Fly   322 EAIVQLQKIAKINGH------------RFDMTEKELAEIYSRDKQDVTYGIASLFAGWRLARNTT 374
            :.:.:|:|:|.|||.            |..| :|||.....|...      ..||....|.:...
  Rat   294 KGLKELKKVAHINGMKKSGDNITMEVVRTSM-KKELEAAKMRPSP------RDLFHTPILRKQIY 351

  Fly   375 IMGFSWCVVAVSYFTLVLFSSRMAGNPFLNFLYQSIVEIPAYVVGRYMGDTYGRRFTNSVSFLIS 439
            |:.|...:..:|...:.:....::.|..|..:..|:..|...|:|.::.:..|||.|..|...:.
  Rat   352 ILSFIRLLFILSGVGVAIHLQHLSNNIELLQILISVSSILFSVIGHFVLNHIGRRITQMVIMFLR 416

  Fly   440 FVTCLPIIVYSTDERYENLMIYLATFIKFLNALTFFTVNLQCLEIYPTCMRQTGVALGTILANAI 504
            .::.|..|.  ..:..|.|...:|...:.|.||::...:|...|:.||.:|.|...:..:..|..
  Rat   417 GISILTAIF--APQEMETLRFIMAMMAEGLAALSYAANSLHANELLPTTLRATARGVIGMFGNIG 479

  Fly   505 GVLAPYLVYLGTTVDIRAPYYILGVLFLLGGIGALFLPETLHKKLPDTMEEAGHFGKHDK 564
            ..|||..:.| .:.....|:...|...:|.|...|.||||.:..|||...:..:..|..:
  Rat   480 FFLAPLCMML-ASYSPNLPWIFYGGFAILSGFIVLLLPETKNNPLPDCTHDVENDWKESR 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 128/536 (24%)
MFS 184..542 CDD:119392 86/391 (22%)
UST4rNP_599206.2 MFS_OAT 109..516 CDD:340932 104/442 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X24
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.