DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7084 and SLC22A31

DIOPT Version :9

Sequence 1:NP_001247235.2 Gene:CG7084 / 42606 FlyBaseID:FBgn0038938 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001371692.1 Gene:SLC22A31 / 146429 HGNCID:27091 Length:446 Species:Homo sapiens


Alignment Length:503 Identity:114/503 - (22%)
Similarity:191/503 - (37%) Gaps:119/503 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WNSNLTKTTEACQNGWSYDKTWYESTIPTDH-----NWVCAKDLFVTNVFVVGRVTEVAGSFILG 191
            ||.       .|.:||.         :|.:.     .|                   :.|..|||
Human     9 WNL-------VCGDGWK---------VPLEQVSHLLGW-------------------LLGCVILG 38

  Fly   192 QMGDSYGRRFVYYISVVFCSLGRLGSIMCTSSYTWFLIMSGIVGLTVNSLFQSPQIIGMEISREE 256
            ...|.:|||.|:..|:|. :.|...|....:|:...|::..:.|.|:.....:..:..:|:.  :
Human    39 AGCDRFGRRAVFVASLVL-TTGLGASEALAASFPTLLVLRLLHGGTLAGALLALYLARLELC--D 100

  Fly   257 DRSRIAFFQSCGW--SIGTTLMPLLYWWLRHWDSFMWLTSIPTAMVLLFSKYVI---ESPRWLIS 316
            ...|:||....|.  .:||.|:|.|...::.|.....|.::.:.::|||..:..   |||.||::
Human   101 PPHRLAFSMGAGLFSVVGTLLLPGLAALVQDWRLLQGLGALMSGLLLLFWGFPALFPESPCWLLA 165

  Fly   317 KQRFREAIVQLQKIAKING-------HRFDMTEKELAEIYSRDKQDVTY---GIASLFAGWRLAR 371
            ..:...|...|.:.|:.:|       ...:....||..:.:|..|...:   |:......|   |
Human   166 TGQVARARKILWRFAEASGVGPGDSSLEENSLATELTMLSARSPQPRYHSPLGLLRTRVTW---R 227

  Fly   372 NTTIMGFSWCV---VAVSYFTLVLFSSRMAGNP-----FLNFLYQSIVEIPAYVVGRYMGDTYGR 428
            |..|:|||..|   :..|:        |.:..|     :|.:..::.:|..|.|......|..||
Human   228 NGLILGFSSLVGGGIRASF--------RRSLAPQVPTFYLPYFLEAGLEAAALVFLLLTADCCGR 284

  Fly   429 RFTNSVSFLISFVTCLPIIVYSTDERYENLMIYLATFIKFLNALTFFTV----NLQCLEIYPTCM 489
            |   .|..|.:.||.|..::.....:|  |..:...|:..|..|....|    :|...|::||.:
Human   285 R---PVLLLGTMVTGLASLLLLAGAQY--LPGWTVLFLSVLGLLASRAVSALSSLFAAEVFPTVI 344

  Fly   490 RQTGVALGTIL-ANAIGVLAPYLVYLGTTVDIRAPYYILGVLF----LLGGIGALFLPETLHKKL 549
            |  |..||.:| |..:|..|..|    .|:..|..:::..|:|    :|..:..|.|||:..:.|
Human   345 R--GAGLGLVLGAGFLGQAAGPL----DTLHGRQGFFLQQVVFASLAVLALLCVLLLPESRSRGL 403

  Fly   550 PDTMEEAGHFGKHDKFFSLPKPPQAAEKDDKLSSHPELTRLRRSETAP 597
            |.::::|                      |:|...|.|....|.:..|
Human   404 PQSLQDA----------------------DRLRRSPLLRGRPRQDHLP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7084NP_001247235.2 2A0119 64..552 CDD:273328 107/456 (23%)
MFS 184..542 CDD:119392 95/389 (24%)
SLC22A31NP_001371692.1 MFS 9..383 CDD:421695 100/433 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.