DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKIP and INPPL1

DIOPT Version :10

Sequence 1:NP_001262827.1 Gene:SKIP / 42601 FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_001427363.1 Gene:INPPL1 / 3636 HGNCID:6080 Length:1280 Species:Homo sapiens


Alignment Length:52 Identity:23/52 - (44%)
Similarity:36/52 - (69%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIR 61
            ||||:||.:|.|..:.||:||||....:.:.||:..||::|||:..||.:::
Human  1226 WLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQ 1277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 23/52 (44%)
SH3 657..710 CDD:473055
SAM_superfamily 742..800 CDD:472832
INPPL1NP_001427363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 919..1140
SH3-binding 966..971
NPXY motif 1005..1008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.