DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKIP and Samd5

DIOPT Version :9

Sequence 1:NP_001262827.1 Gene:SKIP / 42601 FlyBaseID:FBgn0051163 Length:1080 Species:Drosophila melanogaster
Sequence 2:XP_017169459.1 Gene:Samd5 / 320825 MGIID:2444815 Length:182 Species:Mus musculus


Alignment Length:159 Identity:66/159 - (41%)
Similarity:90/159 - (56%) Gaps:38/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREK-- 66
            :|||.|||:||.|.||||||:||||||||:|||:||||||||||..||||.::|:::..|||:  
Mouse     3 TNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRLREQDA 67

  Fly    67 GAASVYFML-------------------------------NDPNSLSG---SMEILCETPPNNEL 97
            .||.:||.|                               .||....|   |.|::  :.|..:|
Mouse    68 AAAGLYFTLEPQPVPPAPLVEAVPPGRRGEPCGSSAQGTRGDPRGQPGAPCSRELV--SYPKLKL 130

  Fly    98 ELVLREQLETDGVRLTAHPYSTPPSSCLS 126
            ::::|::|..||:.|:..|||...|...|
Mouse   131 KIMIRDKLVRDGIHLSKPPYSRKVSGISS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKIPNP_001262827.1 SAM_Samd5 4..65 CDD:188926 42/60 (70%)
SAM 7..65 CDD:197735 40/57 (70%)
SH3 657..710 CDD:302595
SAM 738..801 CDD:197735
SAM_superfamily 742..800 CDD:301707
Samd5XP_017169459.1 SAM_Samd5 2..64 CDD:188926 42/60 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7307
eggNOG 1 0.900 - - E1_KOG4384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006313
OrthoInspector 1 1.000 - - otm42795
orthoMCL 1 0.900 - - OOG6_108165
Panther 1 1.100 - - LDO PTHR12301
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5033
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.