DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13408 and C50D2.6

DIOPT Version :9

Sequence 1:NP_651007.1 Gene:CG13408 / 42597 FlyBaseID:FBgn0038929 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_493656.2 Gene:C50D2.6 / 3565416 WormBaseID:WBGene00016809 Length:272 Species:Caenorhabditis elegans


Alignment Length:221 Identity:41/221 - (18%)
Similarity:73/221 - (33%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SVILIYFVILLRLVNLVLAQNE------GNISESTVATGREECGSTQKMVDECFKDLPPHLMDFL 67
            |.||.|..        ||:::.      ||..|..:|..::...:|..:..|....|.   :..|
 Worm     4 SSILFYLA--------VLSESTWSSFPGGNCIEPCIAEMQQSLEATPLLQSEQLGQLS---LSSL 57

  Fly    68 QNTKIVISKKEITAK-----CNIFNRGMRCFDTYSKRCLDDRKMGTFKNNVEGARRFFYKFCGDA 127
            .:|.   |.||:|.:     |..:.|...|..:..|   ..:...:.:....|.|    ..|  .
 Worm    58 VSTS---SNKELTERSFYDICQAYTRVDLCLHSCEK---VSQHSASIRKTYAGIR----FIC--V 110

  Fly   128 DFQRDYLRHKDCFA-YIQLDWVTCTTEFENILSEE-------VHDERRNASEKFLEFCCARYAYE 184
            :.:.::.|...|.| :.::....|..:..:.|:..       :..|..|....|...|....:..
 Worm   111 EHRDEFFRSLPCLAEHEKIALQQCRPQINDSLAASNRFSVTVLRKEHHNLRSHFEMLCKKLGSMI 175

  Fly   185 NCIYNSARFKCYKNSAEFARETAKML 210
            .|:....|..|       ..:.|||:
 Worm   176 ECVEPVTRAGC-------GDQAAKMM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13408NP_651007.1 None
C50D2.6NP_493656.2 CPG4 <64..134 CDD:373884 13/78 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.