DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13408 and ZK816.4

DIOPT Version :9

Sequence 1:NP_651007.1 Gene:CG13408 / 42597 FlyBaseID:FBgn0038929 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_508578.2 Gene:ZK816.4 / 191431 WormBaseID:WBGene00022827 Length:260 Species:Caenorhabditis elegans


Alignment Length:181 Identity:42/181 - (23%)
Similarity:70/181 - (38%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CGST-QKMVDECFKDL--------PPHLM---DFLQNTKIVISKKEITAKCNIFNRGMRCFDTYS 97
            ||.. |:.|.||...|        ..|.:   .|:..||...|:     .|:.|.....|.:.|.
 Worm    59 CGEVEQEKVKECADPLYKMGAISENSHYLGWEGFIFRTKAYFSE-----VCDNFFLFDVCIEPYK 118

  Fly    98 KRCL-DDRKMGTFKNNVEGARRFFYKFCGDADFQRDYLRHKDCF--AYIQLDWVTCTTEFENILS 159
            ..|. .||.    :.|.:.|.:.....|.|.  ..:.||:.:||  ...:.:.:.|..|   ::|
 Worm   119 DVCFAADRA----RFNYDAAIKILDFLCRDG--YGEMLRNIECFTKTLTRSEMMQCQAE---LVS 174

  Fly   160 E-----EVHDERRNASEKFLEFCCARYAYENCIYNSARFKCYKNSAEFARE 205
            :     |.|.|.:.|::..:  |.|...|.:|:....|::|...:.:..||
 Worm   175 DTRKISESHSEVKGANDAAV--CGAMRNYIDCVKYPIRYECGFRAWQLVRE 223



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.