DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13408 and Y41G9A.2

DIOPT Version :9

Sequence 1:NP_651007.1 Gene:CG13408 / 42597 FlyBaseID:FBgn0038929 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_508510.2 Gene:Y41G9A.2 / 180584 WormBaseID:WBGene00021526 Length:242 Species:Caenorhabditis elegans


Alignment Length:109 Identity:23/109 - (21%)
Similarity:39/109 - (35%) Gaps:28/109 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 TCTTEFENIL---SEE----------------VHDERRNASEKFLEFCCARYAYENCIYNSARFK 194
            ||..:.||.:   |||                :.|.:.::...|::.|.|...:.||:..|    
 Worm    39 TCDAQAENKIAQCSEELISMGVFSALGGKQTTLSDMKSHSQIHFVQMCGAYQRFNNCLGGS---- 99

  Fly   195 CYKNSAEFARETAKMLSDEKHFRNCAVLQNICAHDAAVALAQWH 238
             |...|.:..|..|    .::....:||..:|.......|..|:
 Worm   100 -YIKQACYPHEPLK----SRYSVVDSVLDYVCGEGYQSMLNNWN 138



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.