DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and MSL5

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_013217.1 Gene:MSL5 / 850807 SGDID:S000004106 Length:476 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:71/242 - (29%)
Similarity:122/242 - (50%) Gaps:38/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVAQQQQAQAQAQAQAQAQQQQQAPQVVVPMTPQHLTPQQQQQSTQS---IADYLAQLLKDRKQL 89
            |:.::|....|...:.|        ::.:.:......|..::..:.|   :.|...:....|:| 
Yeast    57 ALTREQIYSYQVMFRIQ--------EITIKLRTNDFVPPSRKNRSPSPPPVYDAQGKRTNTREQ- 112

  Fly    90 AAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSVVT-MNEKVYVPVREHPDFNF 153
                   .:.::|.||.|..|..:|      |..|..:|..:....| ..:|.|:||.::||.||
Yeast   113 -------RYRKKLEDERIKLVEIAL------KTIPYFVPPDDYKRPTKFQDKYYIPVDQYPDVNF 164

  Fly   154 VGRILGPRGMTAKQLEQETGCKIMVRGKGSMRD-KKKEDANRGKPNWEHLSDDLHVLITVEDTEN 217
            ||.:|||||.|.::|::::.|||.:||:||::: |...|...|..|:|   |.||.|| :.|:|:
Yeast   165 VGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFE---DPLHCLI-IADSED 225

  Fly   218 RATVKLAQAVAEVQKLL---VPQAEGEDELKKRQLMELAIINGTYRD 261
                |:.:.:...|.::   |...||:::||:.||.|||.:|||.|:
Yeast   226 ----KIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLRE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 10/47 (21%)
SF1_like-KH 139..260 CDD:239088 51/124 (41%)
MSL5NP_013217.1 MSL5 1..269 CDD:227503 71/242 (29%)
AIR1 <267..386 CDD:227414 1/2 (50%)
PHA03247 <363..435 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.