DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and AT1G09660

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001320903.1 Gene:AT1G09660 / 837494 AraportID:AT1G09660 Length:298 Species:Arabidopsis thaliana


Alignment Length:248 Identity:84/248 - (33%)
Similarity:123/248 - (49%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PMTPQHLTPQQQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRA--------- 112
            |::....:|.:..........||.:||::|::|..|..|..:..|||:.||.||.:         
plant    24 PLSGFRASPNRSPCPPSDRERYLTELLQERQKLGPFLQVMPNCCRLLNHEIRRVSSFPDLDRYEH 88

  Fly   113 -----SLFQ-ING------------------VKKEPLTLPEPEG----------SVVTMNEKVYV 143
                 ||.| .||                  .:..|...|.|.|          .:|....::.|
plant    89 GSPFRSLGQPTNGKLDLEGWSMMQAEENCHLQRASPFRGPSPVGWIGMPGLPNPPIVKKVIRLDV 153

  Fly   144 PVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHV 208
            ||.::|.:|||||||||||.:.|::|..|.|::.:||:||::|..||:..:|||.:|||.:.|||
plant   154 PVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKDTVKEEKLKGKPGYEHLCEPLHV 218

  Fly   209 LITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRD 261
            ||..|..|:....:|..||..::.||.|..|..|..|:.||.|||.:|||.|:
plant   219 LIEAELPEDIINSRLEHAVHFLESLLKPMDESMDHYKREQLKELAALNGTLRE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 20/80 (25%)
SF1_like-KH 139..260 CDD:239088 56/120 (47%)
AT1G09660NP_001320903.1 STAR_dimer 45..90 CDD:406848 15/44 (34%)
KH-I 146..246 CDD:412160 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565749at2759
OrthoFinder 1 1.000 - - FOG0001806
OrthoInspector 1 1.000 - - otm2977
orthoMCL 1 0.900 - - OOG6_104884
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.