DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and AT5G56140

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_200425.1 Gene:AT5G56140 / 835713 AraportID:AT5G56140 Length:315 Species:Arabidopsis thaliana


Alignment Length:269 Identity:86/269 - (31%)
Similarity:129/269 - (47%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VVPMTPQHLTPQQQQQSTQSI----ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLF 115
            |.|..||........:|..|:    ..||::||.:|.:|..|..|..|..|||::||.||...|.
plant    38 VPPSAPQSPNYSGGLRSQSSVFVEQEKYLSELLAERHKLTPFLPVLPHAFRLLNQEILRVTTLLE 102

  Fly   116 QINGVKKEPLTLPEP------------------------------------------EGSVVTMN 138
            ....:.:..|..|.|                                          .|.:....
plant   103 NATVLSQSGLDHPSPLASGGIFQNARADMNGWASQFPSERSVPSSPGPNWLNSPGSSSGLIAKRT 167

  Fly   139 EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLS 203
            .:|.:||..:|:||||||:|||||.:.|::|..|.|::::||:||::|..||:..||||.:|||:
plant   168 IRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLN 232

  Fly   204 DDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRD---TTAK 265
            :.||:|:..|........:|.||...:..||.|..|..|..||:||.|||::|||.|:   ..:.
plant   233 EPLHILVEAELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLREEGSPMSG 297

  Fly   266 SVAAFSCVG 274
            ||:.::.:|
plant   298 SVSPYNSLG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 17/51 (33%)
SF1_like-KH 139..260 CDD:239088 55/120 (46%)
AT5G56140NP_200425.1 STAR_dimer 65..>97 CDD:406848 14/31 (45%)
KH-I 165..265 CDD:412160 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1856
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565749at2759
OrthoFinder 1 1.000 - - FOG0001806
OrthoInspector 1 1.000 - - otm2977
orthoMCL 1 0.900 - - OOG6_104884
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.