DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and AT4G26480

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001320071.1 Gene:AT4G26480 / 828754 AraportID:AT4G26480 Length:308 Species:Arabidopsis thaliana


Alignment Length:272 Identity:90/272 - (33%)
Similarity:137/272 - (50%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PQVVVPMTPQHLTP------QQQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARV 110
            |..|.|..||  :|      :.|.........||::||.:|.:|..|..|..||.||:::||.||
plant    31 PLSVPPSAPQ--SPNFSGGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRV 93

  Fly   111 --------------------RASLFQ-----ING----------VKKEP----LTLP-EPEGSVV 135
                                ...:||     :||          |...|    |..| ...|.:|
plant    94 TTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGSSSGLIV 158

  Fly   136 TMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWE 200
            ....:|.:||.::|::|||||:|||||.:.|::|..|.|::::||:||::|..|||..||||.:|
plant   159 KRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYE 223

  Fly   201 HLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRD---T 262
            ||::.||:|:..|........:|.||...:..||.|..|..|..||:||.|||::||:.|:   .
plant   224 HLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSP 288

  Fly   263 TAKSVAAFSCVG 274
            .:.|::.::.:|
plant   289 MSGSISPYNSLG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 21/82 (26%)
SF1_like-KH 139..260 CDD:239088 54/120 (45%)
AT4G26480NP_001320071.1 STAR_dimer 61..>93 CDD:406848 14/31 (45%)
KH-I 159..259 CDD:412160 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I1856
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565749at2759
OrthoFinder 1 1.000 - - FOG0001806
OrthoInspector 1 1.000 - - otm2977
orthoMCL 1 0.900 - - OOG6_104884
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1339
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.