DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and AT3G08620

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:256 Identity:79/256 - (30%)
Similarity:132/256 - (51%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TPQQQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVR----------------- 111
            :||.:..|:...:.|::|||.:.::|..|..|.....|||::||.|:.                 
plant    17 SPQIRTPSSDVDSQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRITGMMPNQGFTDFDRLRHR 81

  Fly   112 ----------------ASLFQINGVKKEPLTLP------------EPEGSVVTMNEKVYVPVREH 148
                            ..|...||:..|.:..|            .|....|....::.:||..:
plant    82 SPSPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILRLDLPVDTY 146

  Fly   149 PDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVE 213
            |:||||||:|||||.:.|::|..|||::.:|||||::|.:||:..:|||.:|||::.||:||..:
plant   147 PNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGKPGYEHLNEQLHILIEAD 211

  Fly   214 DTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIINGTYRDTT---AKSVAAFS 271
            ...:...:||.||...:::|:.|..|.:|.:|::||.|||::|...|:.:   :.||:.|:
plant   212 LPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPFN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 16/80 (20%)
SF1_like-KH 139..260 CDD:239088 52/120 (43%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848 13/45 (29%)
KH-I 134..234 CDD:412160 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565749at2759
OrthoFinder 1 1.000 - - FOG0001806
OrthoInspector 1 1.000 - - otm2977
orthoMCL 1 0.900 - - OOG6_104884
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.