DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and AT2G38610

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_181395.1 Gene:AT2G38610 / 818443 AraportID:AT2G38610 Length:286 Species:Arabidopsis thaliana


Alignment Length:236 Identity:78/236 - (33%)
Similarity:123/236 - (52%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QQQSTQSI--ADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARV-------------------- 110
            |.:||..|  :.||.:||.:.::|..|..|.....|||::|:.||                    
plant    20 QIRSTPEIDSSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRVSGMMSNQGFGDFDRLRHRSP 84

  Fly   111 -------------RASLFQINGVKKEPLT-----------LP-EPEGSVVTMNEKVYVPVREHPD 150
                         ...|...||:.:|.|:           .| .|....|....::.:||..:|:
plant    85 SPMASSNLMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPN 149

  Fly   151 FNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDT 215
            ||||||:|||||.:.|::|..|||::.:|||||::|.:|||..||:|.:|||::.||:||..:..
plant   150 FNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLRGRPGYEHLNEQLHILIEADLP 214

  Fly   216 ENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMELAIIN 256
            .:...::|.||...:::||.|..|.:|.:|::||.|||::|
plant   215 ASIVEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 17/82 (21%)
SF1_like-KH 139..260 CDD:239088 53/118 (45%)
AT2G38610NP_181395.1 STAR_dimer 29..75 CDD:406848 13/45 (29%)
KH-I 135..235 CDD:412160 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565749at2759
OrthoFinder 1 1.000 - - FOG0001806
OrthoInspector 1 1.000 - - otm2977
orthoMCL 1 0.900 - - OOG6_104884
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.