Sequence 1: | NP_001262822.1 | Gene: | how / 42596 | FlyBaseID: | FBgn0264491 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001040836.2 | Gene: | B0280.17 / 4363051 | WormBaseID: | WBGene00044674 | Length: | 260 | Species: | Caenorhabditis elegans |
Alignment Length: | 263 | Identity: | 81/263 - (30%) |
---|---|---|---|
Similarity: | 120/263 - (45%) | Gaps: | 78/263 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 QQSTQ-SIADYLAQLLKDRKQLAAFPNV--------FTHVERLLDEEIARVRASLFQING----- 119
Fly 120 -------------------------VKKEPLTLPEPEG-------SVVTMN-------------- 138
Fly 139 ---------EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANR 194
Fly 195 GKPNWEHLSDDLHVLITV-EDTENRATVKLAQAVAEVQKLLVPQAEGED-ELKKRQLMELAIING 257
Fly 258 TYR 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
how | NP_001262822.1 | STAR_dimer | 75..123 | CDD:293152 | 17/85 (20%) |
SF1_like-KH | 139..260 | CDD:239088 | 55/122 (45%) | ||
B0280.17 | NP_001040836.2 | KH-I | 141..260 | CDD:381803 | 55/122 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5176 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11208 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
4 | 3.870 |