DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and B0280.17

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001040836.2 Gene:B0280.17 / 4363051 WormBaseID:WBGene00044674 Length:260 Species:Caenorhabditis elegans


Alignment Length:263 Identity:81/263 - (30%)
Similarity:120/263 - (45%) Gaps:78/263 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QQSTQ-SIADYLAQLLKDRKQLAAFPNV--------FTHVERLLDEEIARVRASLFQING----- 119
            :.||. |...||..||   |:|....|:        |.:...||..||.||..:...:||     
 Worm     5 ESSTNCSTGSYLDDLL---KELQIMTNIYESNDSVKFRNAHNLLVREIKRVYDAEMIVNGLGSGT 66

  Fly   120 -------------------------VKKEPLTLPEPEG-------SVVTMN-------------- 138
                                     :|.:||.:..|.|       |.:|::              
 Worm    67 PPPSFLGRANAGKDESMDLSSLRNLLKDDPLLMTPPPGLQRRQTFSPMTLSLIGGLKNGCSENEN 131

  Fly   139 ---------EKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANR 194
                     :||:.|.....:.|.|||::||||||.:|||::.|||:.:||||..:|..||:..|
 Worm   132 KEEGKFEKIDKVFFPPETANNTNPVGRLIGPRGMTIRQLEKDLGCKLFIRGKGCTKDDAKEERLR 196

  Fly   195 GKPNWEHLSDDLHVLITV-EDTENRATVKLAQAVAEVQKLLVPQAEGED-ELKKRQLMELAIING 257
            .:..||||.:.:||:|:| .|:|..|:.||    :.::|:|....|..| |||:.|||:||:|.|
 Worm   197 ERVGWEHLKEPIHVMISVRSDSEEAASEKL----SSIKKMLQEFLEHTDSELKRSQLMQLAVIEG 257

  Fly   258 TYR 260
            |.:
 Worm   258 TLK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 17/85 (20%)
SF1_like-KH 139..260 CDD:239088 55/122 (45%)
B0280.17NP_001040836.2 KH-I 141..260 CDD:381803 55/122 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.