DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and CG3927

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster


Alignment Length:235 Identity:77/235 - (32%)
Similarity:125/235 - (53%) Gaps:36/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TPQHLTPQQQQQS-------TQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQ 116
            ||..||.:|.|..       .:....:||.|..:||:|:|   .|.....|:||.:.|| .|..:
  Fly     3 TPSELTEKQNQDQPTYQPRLNEVAQKFLADLDAERKRLSA---EFPLCALLIDESVDRV-YSTGR 63

  Fly   117 INGVKKEPLT---LPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMV 178
            |.|  |||..   ..:|    :.:.:||:|||.:.|.|||.|:||||:|.:.::|::||.|||::
  Fly    64 IPG--KEPFADVYQQKP----MKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVI 122

  Fly   179 RGKGSMRDKKKEDANR--GKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGE 241
            :|:.||||:.||:..|  |.|.:.||..||.:.::..........::|.|:||::|.|:|  :..
  Fly   123 KGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIP--DDN 185

  Fly   242 DEL---KKRQLMEL---------AIINGTYRDTTAKSVAA 269
            |::   ::|:|||:         .:....||....|::.|
  Fly   186 DDVWHEQQRELMEMNPKSAKKSNGLNMAPYRSNFDKAIGA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 16/47 (34%)
SF1_like-KH 139..260 CDD:239088 47/134 (35%)
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460725
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D66954at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.