DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and qkr58E-2

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster


Alignment Length:222 Identity:63/222 - (28%)
Similarity:119/222 - (53%) Gaps:31/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGVKKEPLTLPEP- 130
            ::.|...::..|:.:|:.:|.::   .|.|....:|:||.:.||     |:||      .:|.. 
  Fly    65 EKAQPAPAVQKYMQELMTERSRM---ENHFPLAVKLIDEALERV-----QLNG------RIPTRD 115

  Fly   131 ------EGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKK 189
                  :...:.:::||:||::: ..||:||::|||:|.:.::|::||.|||::.|:.||:|:.:
  Fly   116 QYADVYQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAR 179

  Fly   190 ED--ANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKRQLMEL 252
            |:  .|.....:.||:..|||.::.......|..::|.|:||:::.|.|  :..|::::.|..||
  Fly   180 EEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTP--DKHDDIRQEQYREL 242

  Fly   253 -----AIINGTYRDTTAKSVAAFSCVG 274
                 |....|.|....:|.||.|..|
  Fly   243 MEDPEAAKKLTLRQLQQQSNAAASGAG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 13/47 (28%)
SF1_like-KH 139..260 CDD:239088 42/127 (33%)
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 40/117 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460726
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D66954at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.