DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and Y57G11C.36

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001379320.1 Gene:Y57G11C.36 / 259844 WormBaseID:WBGene00013325 Length:380 Species:Caenorhabditis elegans


Alignment Length:248 Identity:79/248 - (31%)
Similarity:124/248 - (50%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AQQQQQAPQVVVP----------MTPQHLTPQQQQQSTQSIADYLAQLLKDRKQLAAFPN-VFTH 98
            |::.|.:..:..|          .|..| :.|:..::...:..|:..|..::.|||.:.: .|.|
 Worm    18 AEKHQHSSLLTPPPSDDSQKSLKSTSNH-SDQEMSKNLHDVEAYIDALKGEKHQLAQYSSGGFNH 81

  Fly    99 VERLLDEEIARVRASLFQINGVKKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGM 163
            |..|:|:||.:|..:.....|.:.      ..:||::|  |.:.|||.:.||:|||||:|||||.
 Worm    82 VFNLIDKEIQKVGGNDAHDGGSQM------SGDGSMLT--ETIMVPVEKFPDYNFVGRLLGPRGT 138

  Fly   164 TAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVA 228
            ||||||..|||:|.:.|      :.|.|.:...|  :..:..|.|.|:|.....:|...|...|.
 Worm   139 TAKQLEVTTGCRITILG------RTKRDGSSSNP--DVTTGPLRVQISVPADMPQAAKLLKGGVG 195

  Fly   229 EVQKLLVPQAEGEDELKKRQLMELAIINGTYRDTTAKSVAAFSCVGSASYLYP 281
            .:|.:|....:|.||||::||:.||.:||||:..     .:.:..||..|.:|
 Worm   196 HIQAILDVPTDGNDELKRQQLLILANMNGTYQPR-----GSATSPGSGDYGHP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 14/48 (29%)
SF1_like-KH 139..260 CDD:239088 51/120 (43%)
Y57G11C.36NP_001379320.1 MSL5 <85..225 CDD:227503 58/155 (37%)
KH-I 112..>162 CDD:412160 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1833
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.