DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and F54D1.1

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_502114.1 Gene:F54D1.1 / 186227 WormBaseID:WBGene00010046 Length:278 Species:Caenorhabditis elegans


Alignment Length:257 Identity:66/257 - (25%)
Similarity:106/257 - (41%) Gaps:80/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQ-------------------------I 117
            ||.:|:.:.:||:..|....:...||.:||::|...|::                         .
 Worm     9 YLNELINEMRQLSETPIDCKNARMLLSKEISKVFDELYRHGQGFIDNGYGSDYNKNDFYSPHSAN 73

  Fly   118 NGVKKEPL----TLPEP-------EGSVVT----------------------------MNEKVYV 143
            :|....|.    :||..       ..|.:|                            :..|||:
 Worm    74 SGYSASPFPSRPSLPNHALSTSFYHNSFMTPIRNGRMRSPDQDLGDWSREKINDTQHVLQTKVYI 138

  Fly   144 PVREHP--------DFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWE 200
            |  |.|        ..|::||||||.||:|:.:|.:....:::||.||:|:|..::..| |.| |
 Worm   139 P--EPPVSIDGKKVKCNYIGRILGPSGMSARMIENQYDVTLLIRGAGSVRNKAMDERVR-KRN-E 199

  Fly   201 HLSDDLHVLITVEDTENRATVKLAQAVAE-VQKLLVPQAEGEDELKKRQLMELAIINGTYRD 261
            ||.:.||||:.....:.....::....|| ::.||.|.   .||.|..||:..|.:||||::
 Worm   200 HLEEPLHVLLIARHNDKTKCEEILNKAAEKIESLLTPI---HDEYKMDQLVSYAKMNGTYQE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 13/69 (19%)
SF1_like-KH 139..260 CDD:239088 47/129 (36%)
F54D1.1NP_502114.1 SF1_like-KH 133..257 CDD:239088 47/130 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.