DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment how and qkib

DIOPT Version :9

Sequence 1:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021336383.1 Gene:qkib / 100462714 ZFINID:ZDB-GENE-081028-54 Length:176 Species:Danio rerio


Alignment Length:170 Identity:105/170 - (61%)
Similarity:134/170 - (78%) Gaps:6/170 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QQQQSTQSIADYLAQLLKDRKQLAAFPN---VFTHVERLLDEEIARVRASLFQ--ING-VKKEPL 125
            :.::..:...|||.||:.|:|.:::.||   :|.|:||||||||:|||..::.  :|| .:|...
Zfish     6 ETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSS 70

  Fly   126 TLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKE 190
            .||:..|.:|.:.||:||||:|:||||||||||||||:||||||.||||||||||||||||||||
Zfish    71 ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKE 135

  Fly   191 DANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEV 230
            :.||||||||||::||||||||||.:|||.:||.:||.||
Zfish   136 EQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 24/53 (45%)
SF1_like-KH 139..260 CDD:239088 76/92 (83%)
qkibXP_021336383.1 STAR_dimer 10..68 CDD:318695 24/57 (42%)
SF1_like-KH 83..>175 CDD:239088 74/91 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4590
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 300 1.000 Inparanoid score I2664
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001806
OrthoInspector 1 1.000 - - otm25871
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.