DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pit and AT5G05450

DIOPT Version :9

Sequence 1:NP_001287459.1 Gene:pit / 42595 FlyBaseID:FBgn0266581 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_196164.1 Gene:AT5G05450 / 830428 AraportID:AT5G05450 Length:593 Species:Arabidopsis thaliana


Alignment Length:522 Identity:180/522 - (34%)
Similarity:283/522 - (54%) Gaps:45/522 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 FASLKGAVSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINK 251
            |:.|:..:|...:.|:.:..|...|.:|:.::..|...:|:...|.|||||||||::|.||::.:
plant    16 FSDLEPPLSGDIIEALNQSDFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRR 80

  Fly   252 LRFMPRNGTGV--IIISPTRELSMQTFGVLKELMAHHHHTYG-LVMGGSNRQVESE-KL--GKGI 310
            ....|.....|  :|||||||||.|.:.|.:..::...:... |::||  |:|::: |:  .:|.
plant    81 STSFPPKPHQVMGVIISPTRELSTQIYNVAQPFVSTLANVNSVLLVGG--REVKADMKIIEEEGC 143

  Fly   311 NILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQ 375
            |:|:.|||||.|.::......::||:.||:||.||:||:||:.::..||:.|||:|:|.||||||
plant   144 NVLIGTPGRLSDIMERMEILDFRNLEILILDEADRLLEMGFQRQVNYIISRLPKQRRTGLFSATQ 208

  Fly   376 TARIEALSKLALKSEPIYVGVHDNQ---------DTATVDGLEQGYIVCPSEKRLLVLFTFLKKN 431
            |..:|.|:|..|:: |:.|.|....         ::.|..||...|:.|.::|:...|...|.||
plant   209 TEGVEELAKAGLRN-PVRVEVRAKSKSESSQQLTNSKTPSGLHLEYMECEADKKSSQLVDLLIKN 272

  Fly   432 RKKKVMVFFSSCMSVKYHHELFNYI----DLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDV 492
            ..||::|||.:|.||.|...:.:.|    .:.:..|||..||..|......|..|.||.||||||
plant   273 SDKKLIVFFMTCASVDYWGLVLSKIPALKSISLIPIHGDMKQNARDKALASFTKASSGALLCTDV 337

  Fly   493 AARGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLRYLKAAKVPLN 557
            ||||||||.:|::||||||.||..:.||.||||| .|..|.|::.:.|:|..::.:::..:|||.
plant   338 AARGLDIPGIDYVVQYDPPQDPNMFNHRAGRTAR-LGRQGRAIVFLLPKEEAYVEFMRIRRVPLE 401

  Fly   558 EFEFSWQKIADIQLQLEKLIAKNYFLNQSAKEAFKSYVRAYDSHQLKQIFNVNTLDLQAVAKSFG 622
            |.:.| :..:|:...:.....|:..:.:...:||.|:||||..|....||....|::..:|..:|
plant   402 ERKCS-EDASDVIPIIRSAAMKDRAVMEKGLKAFVSFVRAYKEHHCSFIFRWKDLEIGKLAMGYG 465

  Fly   623 FL-VPPVVDLKVGAAKRERPEKRVGGGGF-----------GFYKKMNEGSASKQRHFKQVNRDQA 675
            .| :|.:.::|         :.|:...||           .|..|..|....:....::..|.:.
plant   466 LLYLPSMSEVK---------QHRLSSEGFTPVEGVKFEEIKFKDKYREKQRQQNLQVRKEKRQEE 521

  Fly   676 KK 677
            ||
plant   522 KK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitNP_001287459.1 SrmB 186..677 CDD:223587 178/520 (34%)
DEADc 187..394 CDD:238167 81/212 (38%)
HELICc 408..537 CDD:238034 61/132 (46%)
DUF4217 569..627 CDD:290667 15/58 (26%)
AT5G05450NP_196164.1 SrmB 12..501 CDD:223587 175/498 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.