DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pit and eIF4A

DIOPT Version :9

Sequence 1:NP_001287459.1 Gene:pit / 42595 FlyBaseID:FBgn0266581 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:458 Identity:121/458 - (26%)
Similarity:220/458 - (48%) Gaps:82/458 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 DEEEPVPAKKTKLLPNKSKAQNGKPAKDDEPFTVESSLAALDYRDSDDRSFASLKGAVSEATLRA 201
            |:...:|             |:| ||..:....:||:...: |.:.||.:       :.|..||.
  Fly     2 DDRNEIP-------------QDG-PASMEPEGVIESTWHEV-YDNFDDMN-------LREELLRG 44

  Fly   202 IKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGV---- 262
            |...||.:.:.||.:::.|.::|||::..||:|:|||..|.|..::.|:         |.:    
  Fly    45 IYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQID---------TSIRECQ 100

  Fly   263 -IIISPTRELSMQTFGV---LKELMAHHHHTYGLVMGGSNRQVESEKLGKGINILVATPGRLLDH 323
             :|::|||||:.|...|   |.|.|..|.|.   .:||:|.:.::..|..|.:::|.||||:.|.
  Fly   101 ALILAPTRELATQIQRVVMALGEYMKVHSHA---CIGGTNVREDARILESGCHVVVGTPGRVYDM 162

  Fly   324 LQNSPDFLYKNLQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTARIEALSKLALK 388
            : |......:.::..::||.|.:|..||:::::.:..:||...|.:|.|||....:..:|:..::
  Fly   163 I-NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMR 226

  Fly   389 SEPIYVGVHDNQDTATVDGLEQGYI-----------VCPSEKRLLVLFTFLKKNRKKKVMVFFSS 442
             :|:.:.|  .::..|::|::|.|:           :|.....|.:..:.:..|.::||......
  Fly   227 -DPVSILV--KKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQE 288

  Fly   443 CMSVKYHHELFNYIDLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQ 507
             ||:.         :..|:::||..:|..|.....||.:..|.:|:.||:.|||:|:.||..::.
  Fly   289 -MSIH---------NFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVIN 343

  Fly   508 YDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELGFLR------YLKAAKVPLNEFEFSWQKI 566
            ||.|.:...||||:||..| .|..|.|:..:..::...|:      :....::|.|        |
  Fly   344 YDLPSNRENYIHRIGRGGR-FGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPAN--------I 399

  Fly   567 ADI 569
            ||:
  Fly   400 ADL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pitNP_001287459.1 SrmB 186..677 CDD:223587 110/409 (27%)
DEADc 187..394 CDD:238167 62/214 (29%)
HELICc 408..537 CDD:238034 39/139 (28%)
DUF4217 569..627 CDD:290667 0/1 (0%)
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 120/454 (26%)
DEADc 32..232 CDD:238167 64/220 (29%)
Helicase_C 254..358 CDD:278689 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.