DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fadd and FADD

DIOPT Version :9

Sequence 1:NP_651006.1 Gene:Fadd / 42594 FlyBaseID:FBgn0038928 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_003815.1 Gene:FADD / 8772 HGNCID:3573 Length:208 Species:Homo sapiens


Alignment Length:221 Identity:50/221 - (22%)
Similarity:94/221 - (42%) Gaps:61/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TENVEQLKLIFVEEIGSRRRSDCIRTIEDLIDCLERADELSEYNVEPLRRISGNMPQLIEALSAY 85
            :..:.:||.:.:..:| :|:.:.:::..||...|     |.:.::||     |:...|.|.|::.
Human    17 SSELTELKFLCLGRVG-KRKLERVQSGLDLFSML-----LEQNDLEP-----GHTELLRELLASL 70

  Fly    86 TKPENILGHPVNLYQELRLAEELRQQLRIAPASQNAQPSVSELAAAVPPTAIQNYATPAAFTDHK 150
            .:           :..||..::..     |.|:..|.|...:|.||                   
Human    71 RR-----------HDLLRRVDDFE-----AGAAAGAAPGEEDLCAA------------------- 100

  Fly   151 RTMVFKKISEELGRYWRRLGRSAGIGEGQMDTIEERYPHDLKSQI---LRLLQLIEEDDCHDPKH 212
                |..|.:.:|:.||||.|...:.:.::|:||:|||.:|..::   ||:.:..|:::.     
Human   101 ----FNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENA----- 156

  Fly   213 FLLRLCRALGDCGRN---DLRKRVEQ 235
            .:..|..||..|..|   ||.:.|:|
Human   157 TVAHLVGALRSCQMNLVADLVQEVQQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaddNP_651006.1 DD 22..>71 CDD:301326 10/48 (21%)
Death 154..234 CDD:260017 25/85 (29%)
FADDNP_003815.1 DED_FADD <24..82 CDD:260043 15/79 (19%)
Death_FADD 97..181 CDD:260020 28/111 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..208
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12468
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619689at2759
OrthoFinder 1 1.000 - - FOG0008143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15077
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.