DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fadd and Fadd

DIOPT Version :9

Sequence 1:NP_651006.1 Gene:Fadd / 42594 FlyBaseID:FBgn0038928 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_690920.1 Gene:Fadd / 266610 RGDID:628700 Length:208 Species:Rattus norvegicus


Alignment Length:218 Identity:49/218 - (22%)
Similarity:91/218 - (41%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NVEQLKLIFVEEIGSRRRSDCIRTIEDLIDCLERADELSEYNVEPLRRISGNMPQLIEALSAYTK 87
            ::..||.:..|.: |:|:.:.:::..||...|...::|.       |..:|.:.:|:.:|..:  
  Rat    19 DLTDLKFLCRERV-SKRKLERVQSGLDLFSVLLEQNDLE-------RGHTGLLRELLASLGRH-- 73

  Fly    88 PENILGHPVNLYQELRLAEELRQQLRIAPASQNAQPSVSELAAAVPPTAIQNYATPAAFTDHKRT 152
                     :|.|.|...|        |.|:..|.|..::|..|                     
  Rat    74 ---------DLLQRLDDFE--------AGATTAATPGEADLRVA--------------------- 100

  Fly   153 MVFKKISEELGRYWRRLGRSAGIGEGQMDTIEERYPHDLKSQI---LRLLQLIEEDDCHDPKHFL 214
              |..:.:.:||.|:||.|...:.|.::|.||||||..|..::   ||:.:.:|:::..     :
  Rat   101 --FDIVCDNVGRDWKRLARELKVSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENAS-----V 158

  Fly   215 LRLCRALGDCGRNDLRKRVEQIM 237
            ..|.:||..|..|.:...||:.:
  Rat   159 AGLVKALRACRLNLVADLVEEAL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaddNP_651006.1 DD 22..>71 CDD:301326 10/47 (21%)
Death 154..234 CDD:260017 24/82 (29%)
FaddNP_690920.1 DED_FADD <19..83 CDD:260043 13/63 (21%)
Death_FADD 97..181 CDD:260020 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12023
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619689at2759
OrthoFinder 1 1.000 - - FOG0008143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15077
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.